(data stored in ACNUC7421 zone)

EMBL: CP002293.PE165

CP002293.PE165       Location/Qualifiers
FT   CDS             183843..185468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0169"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="KEGG: bsu:BSU31980 2,3-dihydroxybenzoate-AMP ligase;
FT                   TIGRFAM: 2,3-dihydroxybenzoate-AMP ligase; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73021"
FT                   /db_xref="GOA:A0A0F6BHX0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX0"
FT                   /inference="protein motif:TFAM:TIGR02275"
FT                   /protein_id="ADP73021.1"
FT                   /translation="MLSGCPTWPKEFADFYRKEGCWAGETFGDMLRERALKYGDRIAVT
FT                   SGERQISYKELDRRADQLASGFRQLGIRPADRVVVQLPNRIEFFEVCFALFRLGALPVF
FT                   ALPSHRYSEISYFCEFSEAAAYIIPDQHGGFDFRSLAKQVKAAVPTLKHVIVVGEAGEF
FT                   EPLENLFIDPVQLPLVHSSDVAFFLLSGGSTGLPKMIPRTHDDYIYSLRVSAEICKLHQ
FT                   DSVYLAVLPIAHNYPLSSPGVLGTLYAGGKVVLADSPSPDEAFPLIQQEKVTITALVPP
FT                   LVWIWLDAASSCKYDLSSLQVLQVGGAKFSAEVAKRVKPVLGCTLQQVYGMAEGLVNYT
FT                   RLDDPEELIINTQGKPMSYYDEIRIVDEEDNEVEPGQVGELLTRGPYTIRGYYKAEAHN
FT                   AKAFTADGFYRTGDLVRMTPSGYLVVEGRVKDQINRGGEKIAAEEVENHLLAHPSVRDA
FT                   AVVAMPDEFLGERSCAFIILRDHSVKAAELKAFLQERGVASFKIPDRIEFVDSFPKTAV
FT                   GKINKRALRQIIAEKRQSAGKTNV"
     MLSGCPTWPK EFADFYRKEG CWAGETFGDM LRERALKYGD RIAVTSGERQ ISYKELDRRA        60
     DQLASGFRQL GIRPADRVVV QLPNRIEFFE VCFALFRLGA LPVFALPSHR YSEISYFCEF       120
     SEAAAYIIPD QHGGFDFRSL AKQVKAAVPT LKHVIVVGEA GEFEPLENLF IDPVQLPLVH       180
     SSDVAFFLLS GGSTGLPKMI PRTHDDYIYS LRVSAEICKL HQDSVYLAVL PIAHNYPLSS       240
     PGVLGTLYAG GKVVLADSPS PDEAFPLIQQ EKVTITALVP PLVWIWLDAA SSCKYDLSSL       300
     QVLQVGGAKF SAEVAKRVKP VLGCTLQQVY GMAEGLVNYT RLDDPEELII NTQGKPMSYY       360
     DEIRIVDEED NEVEPGQVGE LLTRGPYTIR GYYKAEAHNA KAFTADGFYR TGDLVRMTPS       420
     GYLVVEGRVK DQINRGGEKI AAEEVENHLL AHPSVRDAAV VAMPDEFLGE RSCAFIILRD       480
     HSVKAAELKA FLQERGVASF KIPDRIEFVD SFPKTAVGKI NKRALRQIIA EKRQSAGKTN       540
     V                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page