(data stored in SCRATCH zone)

EMBL: CP002293.PE166

CP002293.PE166       Location/Qualifiers
FT   CDS             185490..186410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0170"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: bce:BC2305 isochorismatase; PFAM:
FT                   isochorismatase hydrolase; phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73022"
FT                   /db_xref="GOA:A0A0F6BHX1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX1"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADP73022.1"
FT                   /translation="MAIPAIPAYPMPVSSELPKNKVSWTPAAKRAALLIHDMQNYFLDA
FT                   FPSNASPFVELVRNIQRLKKECKEMGIPVIYSAQPGGQTLEQRGLLQDFWGNGIADDPY
FT                   QKGIIDELAPDAKDIVLTKWRYSAFKKTNLLEILEGHGRDQLIICGVYAHIGCLLTASD
FT                   AFMQDIQVFFVADAVADFSLEHHKMALHYAASRCAFITPTQHLIEALKKEPVPDCQNIL
FT                   PMSLHDVRNQVAELIQESPADLSDHENLVNRGLDSIRMMSLVEKWRRAGAEVTFAALAA
FT                   RPTLFAWWNLLSSQSEKVLSAQDSQ"
     MAIPAIPAYP MPVSSELPKN KVSWTPAAKR AALLIHDMQN YFLDAFPSNA SPFVELVRNI        60
     QRLKKECKEM GIPVIYSAQP GGQTLEQRGL LQDFWGNGIA DDPYQKGIID ELAPDAKDIV       120
     LTKWRYSAFK KTNLLEILEG HGRDQLIICG VYAHIGCLLT ASDAFMQDIQ VFFVADAVAD       180
     FSLEHHKMAL HYAASRCAFI TPTQHLIEAL KKEPVPDCQN ILPMSLHDVR NQVAELIQES       240
     PADLSDHENL VNRGLDSIRM MSLVEKWRRA GAEVTFAALA ARPTLFAWWN LLSSQSEKVL       300
     SAQDSQ                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page