(data stored in ACNUC7421 zone)

EMBL: CP002293.PE167

CP002293.PE167       Location/Qualifiers
FT   CDS             186425..193600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0171"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; condensation
FT                   domain protein; Thioesterase; phosphopantetheine-binding;
FT                   KEGG: bsu:BSU31960 siderophore
FT                   2,3-dihydroxybenzoate-glycine-threonine trimeric ester
FT                   bacillibactin synthetase; SMART: Polyketide synthase,
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73023"
FT                   /db_xref="GOA:A0A0F6BHX2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="PDB:5U89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX2"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADP73023.1"
FT                   /translation="MSNRQHIRLPLSGAQAGIWFAQQLDPENPIYNTGEYIEINGPVDP
FT                   ALFEKALRHVLVEAESLHARFGEDENGPWQTIDPSPDFPFYFMDVSAAENPQEEAMLWM
FT                   KKDLSKPVDLTCGPLFTEALFKLSDHRFFWYQRIHHIAIDGFGFSLIAQKVAQVYTALV
FT                   DNAPVDGEKFASLHQVIEEEKAYHASKQYEHDREFWMERFRDRPEAVSLSDRAVRTSNT
FT                   FIRQTAYMSPASTEHFKQSAQHLKASWHEVFIAAAALYIHRLTGADDVILGLPMMNRLG
FT                   SSALNVPAMVMNIVPLRLHLHADMRLSELLSQVRQEIQEVRQHQKYRHEQLRRDLKLLG
FT                   ENQRLFGPQVNIMPFDYALHFGGYQGITHNLAAGPIDDLAINVRTDGNGLRIDFDANPE
FT                   IYSMDELAVHQARFLQLLETMESLEEDELIGKMNLLLEEERHQVLKKWNETAHPHPEEN
FT                   FLQLFEKQAERIPEAIAVICEDQALSYTELNQQANRLAHFLMEYGVGPEQYVALALPRS
FT                   AEMVIAMLAVLKTGAAYLPLDLDYPDERIAFMLEDTKPVCIVTSSSVQSKLSHFPSCST
FT                   IILDHPETEQAIKHYPDTNVPKTQSPLHPAYVIYTSGSTGKPKGVVVPFHSLNNFLLAM
FT                   REKFALKEHDRLLAVTTIAFDISALEIFLPLISGASLVVAKKETIQDPQALAAVISDKE
FT                   ITIMQATPTLWHMLVTHHPDCIAGLRVLVGGEALSSGLASALHRLACEVTNLYGPTETT
FT                   IWSTMSPLHPDDARAPSIGRPIWNTQVYVLDEQLQPVPPGVVGELYIAGSGLARGYLRR
FT                   PDLTAERFVANPYGPPGSRMYRTGDLVRWRMDGSLDYIGRVDHQIKLRGFRIEIGEIEA
FT                   VLSQCDLVERALVVAREDQPGDQRLVAYVIPCEQSKGTLDLAELRRYVSERLPDYMVPS
FT                   AFMVLNEFPLTPNGKIDRKALPAPDFTMTVKGRKPRNPQEEILCELFAEVLEIPVVGID
FT                   DHFFELGGHSLLAARLISRIRDVLGVEITIGKLFASPTVASLVKHLEDAENRKPPVKAY
FT                   ACKEDIPLSFAQRRLWFLYHLEGPSPTYNIPVVVHLTGELHYQALQQALYDVIERHEPL
FT                   RTIFPEHSGASRQVILEPHQARPELMIKEISESELSDELNAAVRYRFDLAAEPAIRAQL
FT                   FVLGPNRHVLLLLMHHMIVDGWSLTPLTRDIAAAYNAHCRNQKVEWAPLPVKYADYALW
FT                   QQEILGDETNPDSLIAKQLDYWKKTLAGLPEELELPTDYPRPAESSYEGGIVDFCMDAE
FT                   LHKRLLDLARENKASLFMVLQAGFAAFLTRLGAGTDIPIGSPIAGRNDDSLEHLVGLFI
FT                   NTLVLRMDTSGNPSFRELLGRVREVNLSAYENQDIPFERLVEILNPVRSRAKHPLFQVM
FT                   FVFQNTPEPKLELQGLESRLEIRSVGTAKFDLTLELRERRGEDGSPDGLIGLFEYSRDL
FT                   FDHTTVEAFAKRLCQLLREVVMNPDLPIGQIDMLLPEERKKLLTKADHNARSVPEECLP
FT                   VLFEKQVQKSPDAIAVSFEDQELSYAELNKRANQLAHFLIEKGVGPERVVALALPRSLE
FT                   MVIGILAVLKAGGTYLPLDPDYPEERIAYMMEDAQPMYVITNKGMASKLPHAGVAGHLI
FT                   IDESHVADMLETYAETNPDDSNRIEALSPYHTAYIIYTSGSTGRPKGVMIPHQNVVRLF
FT                   QSTEHWFQFTSDDVWTLFHSYAFDFSVWEIWGPFLYGGRLVIVPHHVSRSPKEFLQLLV
FT                   EQKVTVLNQTPSAFYQLMQADRENIELSRQLSLRFIIFGGEALELSRLEDWYERHADDM
FT                   PKLINMYGITETTVHVSYMELNKNIIAIKGSSLIGRNIPDLEVYVLDVNLQPVPPGVIG
FT                   EMYVAGAGLARGYLGRPDLTAERFVANPFGLPGSRMYRTGDLAKWRADGTLDYIGRSDH
FT                   QVKIRGYRIELGEIEAVLAKHPDIAQVAVVVREDQPGDKRLVAYIVPAKDVESGELRRY
FT                   VAARLPDYMIPSAFVMIEALPLTPNGKLDRKALPAPDWMIEITDRGPRTPQEEMLCDLF
FT                   MEVLRLPRVGIDDGFFELGGHSLLAVQLMSRIRETFGVELSIGDLFEAPTVAGLAEKLE
FT                   IGSSQSALDILLPLRTSGNQPPLFCVHPAGGLSWCYAGLMTAIGADYPIYGLQARGIAK
FT                   AENLPETLDEMAADYINQMKTVQPEGPYYLLGWSLGGNVAHAMATQLQQQGEEVALLVM
FT                   LDAYPSHFLPIAKAPDEQEALIALLALGGYDPDNMDGKPLNLENTMDMLRRDGSALASL
FT                   DESTILNLKDTYVNSVRILSEYVPQRYKGDLLFFRSTIIPEWFDPIEPEAWLPYIDGKI
FT                   IQHDIHCRHKDMCQPGPLAEIGRVLANKLKEKSHLITINGRGGSE"
     MSNRQHIRLP LSGAQAGIWF AQQLDPENPI YNTGEYIEIN GPVDPALFEK ALRHVLVEAE        60
     SLHARFGEDE NGPWQTIDPS PDFPFYFMDV SAAENPQEEA MLWMKKDLSK PVDLTCGPLF       120
     TEALFKLSDH RFFWYQRIHH IAIDGFGFSL IAQKVAQVYT ALVDNAPVDG EKFASLHQVI       180
     EEEKAYHASK QYEHDREFWM ERFRDRPEAV SLSDRAVRTS NTFIRQTAYM SPASTEHFKQ       240
     SAQHLKASWH EVFIAAAALY IHRLTGADDV ILGLPMMNRL GSSALNVPAM VMNIVPLRLH       300
     LHADMRLSEL LSQVRQEIQE VRQHQKYRHE QLRRDLKLLG ENQRLFGPQV NIMPFDYALH       360
     FGGYQGITHN LAAGPIDDLA INVRTDGNGL RIDFDANPEI YSMDELAVHQ ARFLQLLETM       420
     ESLEEDELIG KMNLLLEEER HQVLKKWNET AHPHPEENFL QLFEKQAERI PEAIAVICED       480
     QALSYTELNQ QANRLAHFLM EYGVGPEQYV ALALPRSAEM VIAMLAVLKT GAAYLPLDLD       540
     YPDERIAFML EDTKPVCIVT SSSVQSKLSH FPSCSTIILD HPETEQAIKH YPDTNVPKTQ       600
     SPLHPAYVIY TSGSTGKPKG VVVPFHSLNN FLLAMREKFA LKEHDRLLAV TTIAFDISAL       660
     EIFLPLISGA SLVVAKKETI QDPQALAAVI SDKEITIMQA TPTLWHMLVT HHPDCIAGLR       720
     VLVGGEALSS GLASALHRLA CEVTNLYGPT ETTIWSTMSP LHPDDARAPS IGRPIWNTQV       780
     YVLDEQLQPV PPGVVGELYI AGSGLARGYL RRPDLTAERF VANPYGPPGS RMYRTGDLVR       840
     WRMDGSLDYI GRVDHQIKLR GFRIEIGEIE AVLSQCDLVE RALVVAREDQ PGDQRLVAYV       900
     IPCEQSKGTL DLAELRRYVS ERLPDYMVPS AFMVLNEFPL TPNGKIDRKA LPAPDFTMTV       960
     KGRKPRNPQE EILCELFAEV LEIPVVGIDD HFFELGGHSL LAARLISRIR DVLGVEITIG      1020
     KLFASPTVAS LVKHLEDAEN RKPPVKAYAC KEDIPLSFAQ RRLWFLYHLE GPSPTYNIPV      1080
     VVHLTGELHY QALQQALYDV IERHEPLRTI FPEHSGASRQ VILEPHQARP ELMIKEISES      1140
     ELSDELNAAV RYRFDLAAEP AIRAQLFVLG PNRHVLLLLM HHMIVDGWSL TPLTRDIAAA      1200
     YNAHCRNQKV EWAPLPVKYA DYALWQQEIL GDETNPDSLI AKQLDYWKKT LAGLPEELEL      1260
     PTDYPRPAES SYEGGIVDFC MDAELHKRLL DLARENKASL FMVLQAGFAA FLTRLGAGTD      1320
     IPIGSPIAGR NDDSLEHLVG LFINTLVLRM DTSGNPSFRE LLGRVREVNL SAYENQDIPF      1380
     ERLVEILNPV RSRAKHPLFQ VMFVFQNTPE PKLELQGLES RLEIRSVGTA KFDLTLELRE      1440
     RRGEDGSPDG LIGLFEYSRD LFDHTTVEAF AKRLCQLLRE VVMNPDLPIG QIDMLLPEER      1500
     KKLLTKADHN ARSVPEECLP VLFEKQVQKS PDAIAVSFED QELSYAELNK RANQLAHFLI      1560
     EKGVGPERVV ALALPRSLEM VIGILAVLKA GGTYLPLDPD YPEERIAYMM EDAQPMYVIT      1620
     NKGMASKLPH AGVAGHLIID ESHVADMLET YAETNPDDSN RIEALSPYHT AYIIYTSGST      1680
     GRPKGVMIPH QNVVRLFQST EHWFQFTSDD VWTLFHSYAF DFSVWEIWGP FLYGGRLVIV      1740
     PHHVSRSPKE FLQLLVEQKV TVLNQTPSAF YQLMQADREN IELSRQLSLR FIIFGGEALE      1800
     LSRLEDWYER HADDMPKLIN MYGITETTVH VSYMELNKNI IAIKGSSLIG RNIPDLEVYV      1860
     LDVNLQPVPP GVIGEMYVAG AGLARGYLGR PDLTAERFVA NPFGLPGSRM YRTGDLAKWR      1920
     ADGTLDYIGR SDHQVKIRGY RIELGEIEAV LAKHPDIAQV AVVVREDQPG DKRLVAYIVP      1980
     AKDVESGELR RYVAARLPDY MIPSAFVMIE ALPLTPNGKL DRKALPAPDW MIEITDRGPR      2040
     TPQEEMLCDL FMEVLRLPRV GIDDGFFELG GHSLLAVQLM SRIRETFGVE LSIGDLFEAP      2100
     TVAGLAEKLE IGSSQSALDI LLPLRTSGNQ PPLFCVHPAG GLSWCYAGLM TAIGADYPIY      2160
     GLQARGIAKA ENLPETLDEM AADYINQMKT VQPEGPYYLL GWSLGGNVAH AMATQLQQQG      2220
     EEVALLVMLD AYPSHFLPIA KAPDEQEALI ALLALGGYDP DNMDGKPLNL ENTMDMLRRD      2280
     GSALASLDES TILNLKDTYV NSVRILSEYV PQRYKGDLLF FRSTIIPEWF DPIEPEAWLP      2340
     YIDGKIIQHD IHCRHKDMCQ PGPLAEIGRV LANKLKEKSH LITINGRGGS E               2391
//

If you have problems or comments...

PBIL Back to PBIL home page