(data stored in ACNUC7421 zone)

EMBL: CP002293.PE168

CP002293.PE168       Location/Qualifiers
FT   CDS             193597..193836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0172"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: sro:Sros_6555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73024"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="PDB:5U89"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX3"
FT                   /inference="protein motif:PFAM:PF03621"
FT                   /protein_id="ADP73024.1"
FT                   /translation="MTNPFENKEGTYLVLINDEGQYSLWPASIAIPPGWNIAFAENTRS
FT                   ACLDYINAHWIDMRPNSLKDGSLSKRDNDYSGVK"
     MTNPFENKEG TYLVLINDEG QYSLWPASIA IPPGWNIAFA ENTRSACLDY INAHWIDMRP        60
     NSLKDGSLSK RDNDYSGVK                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page