(data stored in SCRATCH zone)

EMBL: CP002293.PE169

CP002293.PE169       Location/Qualifiers
FT   CDS             194235..195026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0173"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   bwe:BcerKBAB4_2182 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73025"
FT                   /db_xref="GOA:A0A0F6BHX4"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX4"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ADP73025.1"
FT                   /translation="MTEWQVVNSIPPLSDHTCQVWLSKTTDMQPWHVRMLNDEERKRAQ
FT                   SFRKDQDRARFIVGCALSRLVLATQLNMAPHQVPIDRTCPICHEAHGRPRLPYGFLQWS
FT                   VSHSGNIILVAFTTDAPVGVDVEWMNTAWDFDVVKMADGILTEKEIAHILQMPANDRMR
FT                   GFFIYWTRKEAVLKATGEGLNIPPLNVVVSGPQQAPRLLAFTGRPDGTDDVALHDLDLG
FT                   FNYVAALSIFSKTQKRIEQYDASVLMQQGFGWKDYYISQKS"
     MTEWQVVNSI PPLSDHTCQV WLSKTTDMQP WHVRMLNDEE RKRAQSFRKD QDRARFIVGC        60
     ALSRLVLATQ LNMAPHQVPI DRTCPICHEA HGRPRLPYGF LQWSVSHSGN IILVAFTTDA       120
     PVGVDVEWMN TAWDFDVVKM ADGILTEKEI AHILQMPAND RMRGFFIYWT RKEAVLKATG       180
     EGLNIPPLNV VVSGPQQAPR LLAFTGRPDG TDDVALHDLD LGFNYVAALS IFSKTQKRIE       240
     QYDASVLMQQ GFGWKDYYIS QKS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page