(data stored in SCRATCH zone)

EMBL: CP002293.PE17

CP002293.PE17        Location/Qualifiers
FT   CDS             26312..26797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0017"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gwc:GWCH70_0018 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72873"
FT                   /db_xref="GOA:A0A0F6BHH2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADP72873.1"
FT                   /translation="MVNDEYYMRLAIEEAKQAEQIGEVPIGAIIVQGGNVIARAHNLRE
FT                   TAQRAIAHAEILAIDEACKKAGSWRLEDATLYVTLEPCAMCAGAIVLARIKRVVFGASD
FT                   PKGGCAGTLMNLLQEGRFNHQAEVIGGVLQEECGQMLSNFFRKLREKKKNIGQRSSK"
     MVNDEYYMRL AIEEAKQAEQ IGEVPIGAII VQGGNVIARA HNLRETAQRA IAHAEILAID        60
     EACKKAGSWR LEDATLYVTL EPCAMCAGAI VLARIKRVVF GASDPKGGCA GTLMNLLQEG       120
     RFNHQAEVIG GVLQEECGQM LSNFFRKLRE KKKNIGQRSS K                           161
//

If you have problems or comments...

PBIL Back to PBIL home page