(data stored in ACNUC7421 zone)

EMBL: CP002293.PE172

CP002293.PE172       Location/Qualifiers
FT   CDS             197020..198021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0176"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bbe:BBR47_03430 probable iron-uptake ABC transporter
FT                   substrate binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73028"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX7"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73028.1"
FT                   /translation="MMKRKWLYFSLIALLILILTACGTKQSSAPDKATEGNSASSAAEQ
FT                   EKKAGANETRTIQYLGKSYTVPAKAERIVITGSMETMEDALVLGVKPLGGITVGGKFPD
FT                   MFKEITDSTVSIGEKAQPNIETILKLKPDVIFATAKFPPDVIQKLEKIAPTIPVSHIST
FT                   NWEANLRLLAELTGKQDVAEKVLKEYKEELAAAKAKLGDRLKDKKVVVIRIRGGNIMIY
FT                   REDVFFNPSLYMDLGLTAPQEIKNAQTQEMISLEKFSEMNPDYIFVQFSEDENKDQPDA
FT                   LKNLQNNPIWQSINAVKNNKVFVNVVDPLAQGGTAWSKIHFLKAVVEKLGNE"
     MMKRKWLYFS LIALLILILT ACGTKQSSAP DKATEGNSAS SAAEQEKKAG ANETRTIQYL        60
     GKSYTVPAKA ERIVITGSME TMEDALVLGV KPLGGITVGG KFPDMFKEIT DSTVSIGEKA       120
     QPNIETILKL KPDVIFATAK FPPDVIQKLE KIAPTIPVSH ISTNWEANLR LLAELTGKQD       180
     VAEKVLKEYK EELAAAKAKL GDRLKDKKVV VIRIRGGNIM IYREDVFFNP SLYMDLGLTA       240
     PQEIKNAQTQ EMISLEKFSE MNPDYIFVQF SEDENKDQPD ALKNLQNNPI WQSINAVKNN       300
     KVFVNVVDPL AQGGTAWSKI HFLKAVVEKL GNE                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page