(data stored in ACNUC7421 zone)

EMBL: CP002293.PE173

CP002293.PE173       Location/Qualifiers
FT   CDS             198041..199048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0177"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bcy:Bcer98_2408 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73029"
FT                   /db_xref="GOA:A0A0F6BHX8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHX8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73029.1"
FT                   /translation="MRSKIVSPAFILWLSPIVVVFTIMASILYGAKNIDWETVWNAIFH
FT                   FDPGNVNHQIVMHSRLPRVIGALLIGAFLAMSGAIMQGMTRNYLASPSIMGVSDGSVFA
FT                   ITLCMILAPGASSLDMIMYSLIGSLFAVGIVFGLASLLPNGMSPVRMAIIGTIIGTFLS
FT                   SVSAAMASYFQVSQNVSFWYNARLHQMDPDMIKLAVPFALVGIALALFISKSITILSLG
FT                   EEVSVSLGQRTTLVKAMAVASVVILTGISVALAGNIGFVGLIIPHITRFLVGVDYRWII
FT                   PCAGVLGAIFLALSDIFSRFLNYPFETPIGVVTSLIGVPFFLYLIYKRGGGKHA"
     MRSKIVSPAF ILWLSPIVVV FTIMASILYG AKNIDWETVW NAIFHFDPGN VNHQIVMHSR        60
     LPRVIGALLI GAFLAMSGAI MQGMTRNYLA SPSIMGVSDG SVFAITLCMI LAPGASSLDM       120
     IMYSLIGSLF AVGIVFGLAS LLPNGMSPVR MAIIGTIIGT FLSSVSAAMA SYFQVSQNVS       180
     FWYNARLHQM DPDMIKLAVP FALVGIALAL FISKSITILS LGEEVSVSLG QRTTLVKAMA       240
     VASVVILTGI SVALAGNIGF VGLIIPHITR FLVGVDYRWI IPCAGVLGAI FLALSDIFSR       300
     FLNYPFETPI GVVTSLIGVP FFLYLIYKRG GGKHA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page