(data stored in ACNUC7421 zone)

EMBL: CP002293.PE175

CP002293.PE175       Location/Qualifiers
FT   CDS             200106..200672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0179"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bbe:BBR47_03460
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73031"
FT                   /db_xref="GOA:A0A0F6BHY0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY0"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADP73031.1"
FT                   /translation="MELSQLLRERRSIHVFEDRPVSPELVMELLDTAVWVPNHRMTQPW
FT                   RFILTYGEGRRKIAEAVRKIKESKEPDPSKKKEVGQKFYNKIMSIPMILTVLMREDPNL
FT                   IVREEDYASTSCVIHNFSLLAWEKGIGMVWETYGWLHEPIFRETMGIQPVEKVVGNLHI
FT                   GYPAKIPSAQPRIPAAHLITVFDQA"
     MELSQLLRER RSIHVFEDRP VSPELVMELL DTAVWVPNHR MTQPWRFILT YGEGRRKIAE        60
     AVRKIKESKE PDPSKKKEVG QKFYNKIMSI PMILTVLMRE DPNLIVREED YASTSCVIHN       120
     FSLLAWEKGI GMVWETYGWL HEPIFRETMG IQPVEKVVGN LHIGYPAKIP SAQPRIPAAH       180
     LITVFDQA                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page