(data stored in ACNUC7421 zone)

EMBL: CP002293.PE176

CP002293.PE176       Location/Qualifiers
FT   CDS             200697..201497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0180"
FT                   /product="esterase"
FT                   /note="PFAM: esterase; KEGG: bbe:BBR47_03460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73032"
FT                   /db_xref="GOA:A0A0F6BHY1"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY1"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADP73032.1"
FT                   /translation="MNGTLVTESFAGRELFIYLPPSYGTSRAAFPVVYVQDGGDLFDPR
FT                   QNNSLARLEYMFANGELGELLLVGIEPKNRLDEYTPWHAKALSDKYADFGGQGSDYLSF
FT                   LVEKLKPYIDRKYKTDGRRQQTGIIGASLGGLISIYAAYLYPNVFGKIGSISGSFWYEG
FT                   FIGFMQSKNIDPGLKMYMDVGSIEGIGKQSIQKEMVSKTKEACTILMNNGLASERLRFV
FT                   LEEGAPHGRIFFSKRFPEALKWLYSNETDLPAGGGCPPTSIMHK"
     MNGTLVTESF AGRELFIYLP PSYGTSRAAF PVVYVQDGGD LFDPRQNNSL ARLEYMFANG        60
     ELGELLLVGI EPKNRLDEYT PWHAKALSDK YADFGGQGSD YLSFLVEKLK PYIDRKYKTD       120
     GRRQQTGIIG ASLGGLISIY AAYLYPNVFG KIGSISGSFW YEGFIGFMQS KNIDPGLKMY       180
     MDVGSIEGIG KQSIQKEMVS KTKEACTILM NNGLASERLR FVLEEGAPHG RIFFSKRFPE       240
     ALKWLYSNET DLPAGGGCPP TSIMHK                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page