(data stored in ACNUC7421 zone)

EMBL: CP002293.PE178

CP002293.PE178       Location/Qualifiers
FT   CDS             complement(202781..203782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0182"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bwe:BcerKBAB4_0329 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73034"
FT                   /db_xref="GOA:A0A0F6BHY3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY3"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADP73034.1"
FT                   /translation="MIQSALIKKQRRILVILLILIMATIVIGMGTGYSSLSYDRLIPVL
FT                   FGQGTFKEEFILFSIRLPRIVITLLAGMALALSGAILQGITRNDLADPGILGINSGAGV
FT                   GVAVFFLFFPIQSNSFAYLIPLIAFISALLTACFIYLLSYNRNAGFQPVRLVLIGVGFS
FT                   MALSGAMIVLISSAERTKVDFIAKWLAGNIWGDDWPFILAILPWLIVLIPLTLYKANRL
FT                   NILELNEPMAIGVGLEIQKERILLMITAVALAAAAVSVTGGIAFIGLMAPHIAKALIGP
FT                   RNQLFIPIAILMGGWLLLFADTIGRNIADGIPTGIIVSLIGAPYFIYLLLRK"
     MIQSALIKKQ RRILVILLIL IMATIVIGMG TGYSSLSYDR LIPVLFGQGT FKEEFILFSI        60
     RLPRIVITLL AGMALALSGA ILQGITRNDL ADPGILGINS GAGVGVAVFF LFFPIQSNSF       120
     AYLIPLIAFI SALLTACFIY LLSYNRNAGF QPVRLVLIGV GFSMALSGAM IVLISSAERT       180
     KVDFIAKWLA GNIWGDDWPF ILAILPWLIV LIPLTLYKAN RLNILELNEP MAIGVGLEIQ       240
     KERILLMITA VALAAAAVSV TGGIAFIGLM APHIAKALIG PRNQLFIPIA ILMGGWLLLF       300
     ADTIGRNIAD GIPTGIIVSL IGAPYFIYLL LRK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page