(data stored in ACNUC7421 zone)

EMBL: CP002293.PE180

CP002293.PE180       Location/Qualifiers
FT   CDS             complement(204870..205793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0184"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73036"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADP73036.1"
FT                   /translation="MKKLLIPFIVLIVLVMSACGGKTTENKDNSAAKEKEPETITYQSE
FT                   NGPIEVPAHPKRVVVLSSFAGHVMALGVNIVGVDQWSKMNPRFQDKLKNAEVVTDEDIE
FT                   KIIELNPDLIIGLSNTKNVDKLSKIAPTVTYTYGKVDYLTQFLEIGKLLNKEKEAKAWI
FT                   DDFKKRAQQAGEEIRAKIGENATVSVIENFDKQLYVFGNNWGRGTEILYQEMKLKMPKK
FT                   VEEMALKQGYYALSLEALPQFAGDYLIISKNPDGDTSFQQTETYKNLPAVKNHRVFEAN
FT                   AKEFYFNDPITLEYQLDFFKKHFLGE"
     MKKLLIPFIV LIVLVMSACG GKTTENKDNS AAKEKEPETI TYQSENGPIE VPAHPKRVVV        60
     LSSFAGHVMA LGVNIVGVDQ WSKMNPRFQD KLKNAEVVTD EDIEKIIELN PDLIIGLSNT       120
     KNVDKLSKIA PTVTYTYGKV DYLTQFLEIG KLLNKEKEAK AWIDDFKKRA QQAGEEIRAK       180
     IGENATVSVI ENFDKQLYVF GNNWGRGTEI LYQEMKLKMP KKVEEMALKQ GYYALSLEAL       240
     PQFAGDYLII SKNPDGDTSF QQTETYKNLP AVKNHRVFEA NAKEFYFNDP ITLEYQLDFF       300
     KKHFLGE                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page