(data stored in SCRATCH zone)

EMBL: CP002293.PE181

CP002293.PE181       Location/Qualifiers
FT   CDS             complement(205798..206589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0185"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afl:Aflv_1159 ferrichrome ABC transporter
FT                   (ATP-binding protein); PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73037"
FT                   /db_xref="GOA:A0A0F6BHY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73037.1"
FT                   /translation="MVRLYTKDLNIGYHEQLIVKNLNIQIPDQKITAIIGPNGCGKSTL
FT                   LKTLTRIITPQSGTVVLDGKQIFHENTKILARKMAILPQTPESPGGLTVGELVSYGRFP
FT                   YQKGFGHLTKKDYEVIDWALEVTGTIEFKYRPVDSLSGGQRQRVWIAMALAQETDIIFL
FT                   DEPTTYLDMAHQLEVLELLQKLNVEQGRTIVMVLHDLNQAARFADYIIALKDGKIVKAG
FT                   NGDEVMTRDVLKQVFHIDAEIGRDPRTNKPICLTYHLLKGE"
     MVRLYTKDLN IGYHEQLIVK NLNIQIPDQK ITAIIGPNGC GKSTLLKTLT RIITPQSGTV        60
     VLDGKQIFHE NTKILARKMA ILPQTPESPG GLTVGELVSY GRFPYQKGFG HLTKKDYEVI       120
     DWALEVTGTI EFKYRPVDSL SGGQRQRVWI AMALAQETDI IFLDEPTTYL DMAHQLEVLE       180
     LLQKLNVEQG RTIVMVLHDL NQAARFADYI IALKDGKIVK AGNGDEVMTR DVLKQVFHID       240
     AEIGRDPRTN KPICLTYHLL KGE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page