(data stored in ACNUC7421 zone)

EMBL: CP002293.PE183

CP002293.PE183       Location/Qualifiers
FT   CDS             208627..209481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0187"
FT                   /product="rRNA (adenine-N(6)-)-methyltransferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: bha:BH0380 rRNA adenine N-6-methyltransferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73039"
FT                   /db_xref="GOA:A0A0F6BHY8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHY8"
FT                   /inference="protein motif:PRIAM:2.1.1.48"
FT                   /protein_id="ADP73039.1"
FT                   /translation="MKKQNKRNHRTRKYIEWPNFSGQHLLHNKRIINDLIQIANLTSND
FT                   TVLDLGAGKGALTFPVAEKAGKVIAVEYDPRFVEILKKKAEAYPNIKVIQQDILKLRLP
FT                   KEPFIVVAGIPYAITTPIMKMLLHQPANSLQRAVLVMEKGAAKRFTSYPITNPLILKWR
FT                   MWFDLGYVREISRENFSPPPKVDSAILIIRRKKKLSIPYKYYDSFLGLAEYALKYPQLP
FT                   LYEALKGVFTPPQITRLVRNLGVNRNIAICLLNEIQWGIVFHTMVQYVQRPYWPKAKKH
FT                   KNN"
     MKKQNKRNHR TRKYIEWPNF SGQHLLHNKR IINDLIQIAN LTSNDTVLDL GAGKGALTFP        60
     VAEKAGKVIA VEYDPRFVEI LKKKAEAYPN IKVIQQDILK LRLPKEPFIV VAGIPYAITT       120
     PIMKMLLHQP ANSLQRAVLV MEKGAAKRFT SYPITNPLIL KWRMWFDLGY VREISRENFS       180
     PPPKVDSAIL IIRRKKKLSI PYKYYDSFLG LAEYALKYPQ LPLYEALKGV FTPPQITRLV       240
     RNLGVNRNIA ICLLNEIQWG IVFHTMVQYV QRPYWPKAKK HKNN                        284
//

If you have problems or comments...

PBIL Back to PBIL home page