(data stored in ACNUC7421 zone)

EMBL: CP002293.PE185

CP002293.PE185       Location/Qualifiers
FT   CDS             210548..211297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0189"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: transcriptional activator TipA; PFAM: TipAS
FT                   antibiotic-recognition domain-containing protein;
FT                   regulatory protein MerR; Transcription regulator MerR DNA
FT                   binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73041"
FT                   /db_xref="GOA:A0A0F6BHZ0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ0"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ADP73041.1"
FT                   /translation="MAMKVKEVADLVGISVRTLHYYDEIGLLTPEKTTESGYRLYTDDD
FT                   LEKLQQILFFKELGFPLKKVKEIINSPSFDRYEALVLQRKMLLEKRRRLDKMIATIDKT
FT                   IQHMKGEIQMTNKEKFEGFDFRHNPYEQEARKLWGDEAVDNANAKLRNMSKEEQEAIVK
FT                   AMNSIYQKLAALRHGSPESEEAQAAIKEWYDFLNNNFGNYSLEAFKGLGQMYVDDARFT
FT                   KNIDQFGEGLAKFMRDAMAVFADKNKK"
     MAMKVKEVAD LVGISVRTLH YYDEIGLLTP EKTTESGYRL YTDDDLEKLQ QILFFKELGF        60
     PLKKVKEIIN SPSFDRYEAL VLQRKMLLEK RRRLDKMIAT IDKTIQHMKG EIQMTNKEKF       120
     EGFDFRHNPY EQEARKLWGD EAVDNANAKL RNMSKEEQEA IVKAMNSIYQ KLAALRHGSP       180
     ESEEAQAAIK EWYDFLNNNF GNYSLEAFKG LGQMYVDDAR FTKNIDQFGE GLAKFMRDAM       240
     AVFADKNKK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page