(data stored in ACNUC7421 zone)

EMBL: CP002293.PE187

CP002293.PE187       Location/Qualifiers
FT   CDS             212934..213383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73043"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ2"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1311"
FT                   /protein_id="ADP73043.1"
FT                   /translation="MKSSAANEVIALYQRLLDGWNDRNAAAMAEQFTEKGELIGFDGTQ
FT                   AIGREEIFAHLHPIFENHPTPPYVSKVKDVRFLASDIAILRAIAGMVPPGQSDVDPKLN
FT                   AHHTLVAVKNEECWRIELFQNTPVQFHGRPELAEQMTEELRQLLK"
     MKSSAANEVI ALYQRLLDGW NDRNAAAMAE QFTEKGELIG FDGTQAIGRE EIFAHLHPIF        60
     ENHPTPPYVS KVKDVRFLAS DIAILRAIAG MVPPGQSDVD PKLNAHHTLV AVKNEECWRI       120
     ELFQNTPVQF HGRPELAEQM TEELRQLLK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page