(data stored in ACNUC7421 zone)

EMBL: CP002293.PE188

CP002293.PE188       Location/Qualifiers
FT   CDS             213955..215124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0192"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: gka:GK0345
FT                   transposase of IS654-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73044"
FT                   /db_xref="GOA:A0A0F6BJ82"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ82"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADP73044.1"
FT                   /translation="MSKRSIPNVDWANQLENAIRQFVKEKLELIMREEIKNFLEIEQAG
FT                   TPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSG
FT                   MSTREIGKFIERILGSTYSPATISRITDVVKEDIEKWHARPLHQRYSVLYLDGLYVKLR
FT                   RDTVEKEVIYVVLGVNEEGYREILDFFVGGQESAYVWQEILQQLYQRGVKEVLLGVFDG
FT                   LPGLEEAFKAVYPKADVQRCVVHKVRNTLSRVRKKDQFEMAEDLKLIYRSPNKEIALEM
FT                   FQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKP
FT                   MNSLSSLEAAEKVVYLTVQDFNEKWAERKLRGFAEAQEALERMFEERYH"
     MSKRSIPNVD WANQLENAIR QFVKEKLELI MREEIKNFLE IEQAGTPNMR NGYYQRNLDT        60
     QYGRIEGLLV PRDRNGEFQT QLFAPYQRHT GWLEEAIIRM YQSGMSTREI GKFIERILGS       120
     TYSPATISRI TDVVKEDIEK WHARPLHQRY SVLYLDGLYV KLRRDTVEKE VIYVVLGVNE       180
     EGYREILDFF VGGQESAYVW QEILQQLYQR GVKEVLLGVF DGLPGLEEAF KAVYPKADVQ       240
     RCVVHKVRNT LSRVRKKDQF EMAEDLKLIY RSPNKEIALE MFQQFQSKWS HKYPREVQSW       300
     ANELDVLLTF MDYPSSIRSV IYTTNAIERT IKEIRKRLKP MNSLSSLEAA EKVVYLTVQD       360
     FNEKWAERKL RGFAEAQEAL ERMFEERYH                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page