(data stored in ACNUC7421 zone)

EMBL: CP002293.PE189

CP002293.PE189       Location/Qualifiers
FT   CDS             215287..216513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0193"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gyc:GYMC61_2573 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73045"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ4"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADP73045.1"
FT                   /translation="MPFSYVSHLYCPKCQKTYGTNKKHQLCECGSPLLVAYHLDALRAD
FT                   LSREIIASREPNLWRYHELLPVENPEHIVSLGEGMTPLVPMPRLGKDMDIEQLYMKDEG
FT                   VIPTGTFKARGAAVGISKAKELGVKKLAMPTNGNAGAAWSLYAARAGIQVTVVMPVDAP
FT                   TITRNECAIAGADLYLVNGLISDAGAIVSKAIQERNLYDASTLKEPYRIEGKKTMGLEI
FT                   AEQFSWQLPDVILYPTGGGVGLIGIYKALKELQDLGWVQGKMPRLVAVQAQNCAPIVKA
FT                   WNERKRVSEFWPNSSTVAFGINVPKALGDFLVLDALYKTDGCAIAVEDDAIINEQRNVA
FT                   NLEGAFICPEGAAAFVAARRLRERGWIRRGERVVVLNTGIGLKYTHTVSIEVPILQPGD
FT                   HLPERKDYS"
     MPFSYVSHLY CPKCQKTYGT NKKHQLCECG SPLLVAYHLD ALRADLSREI IASREPNLWR        60
     YHELLPVENP EHIVSLGEGM TPLVPMPRLG KDMDIEQLYM KDEGVIPTGT FKARGAAVGI       120
     SKAKELGVKK LAMPTNGNAG AAWSLYAARA GIQVTVVMPV DAPTITRNEC AIAGADLYLV       180
     NGLISDAGAI VSKAIQERNL YDASTLKEPY RIEGKKTMGL EIAEQFSWQL PDVILYPTGG       240
     GVGLIGIYKA LKELQDLGWV QGKMPRLVAV QAQNCAPIVK AWNERKRVSE FWPNSSTVAF       300
     GINVPKALGD FLVLDALYKT DGCAIAVEDD AIINEQRNVA NLEGAFICPE GAAAFVAARR       360
     LRERGWIRRG ERVVVLNTGI GLKYTHTVSI EVPILQPGDH LPERKDYS                    408
//

If you have problems or comments...

PBIL Back to PBIL home page