(data stored in ACNUC7421 zone)

EMBL: CP002293.PE19

CP002293.PE19        Location/Qualifiers
FT   CDS             28942..29268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0019"
FT                   /product="Uncharacterized protein family UPF0133"
FT                   /note="PFAM: Uncharacterised protein family UPF0133; KEGG:
FT                   gwc:GWCH70_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72875"
FT                   /db_xref="GOA:A0A0F6BHH4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH4"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADP72875.1"
FT                   /translation="MMRGGMGNMQKMMKQMQKMQKEMQKAQEQLAEKTVEGTAGGGMVT
FT                   VIANGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDALKKADELAAEMMGQFTKGLNI
FT                   PGLF"
     MMRGGMGNMQ KMMKQMQKMQ KEMQKAQEQL AEKTVEGTAG GGMVTVIANG HKQILEVKIK        60
     EEVVDPEDIE MLQDLVLAAT NDALKKADEL AAEMMGQFTK GLNIPGLF                    108
//

If you have problems or comments...

PBIL Back to PBIL home page