(data stored in SCRATCH zone)

EMBL: CP002293.PE190

CP002293.PE190       Location/Qualifiers
FT   CDS             217065..217397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0194"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: gwc:GWCH70_0175 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73046"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ5"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP73046.1"
FT                   /translation="MSLRSQLLKGVLEGCILAIIKKESVYGYELSVKLQKFGLNDVSEG
FT                   SIYPLLLRLQKAGLIKGEMRDSPSGPKRKYYHLTEKGEEALQDFIAEWESIRKPVEKIL
FT                   RGGNME"
     MSLRSQLLKG VLEGCILAII KKESVYGYEL SVKLQKFGLN DVSEGSIYPL LLRLQKAGLI        60
     KGEMRDSPSG PKRKYYHLTE KGEEALQDFI AEWESIRKPV EKILRGGNME                  110
//

If you have problems or comments...

PBIL Back to PBIL home page