(data stored in SCRATCH zone)

EMBL: CP002293.PE191

CP002293.PE191       Location/Qualifiers
FT   CDS             217394..218086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73047"
FT                   /db_xref="GOA:A0A0F6BHZ6"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHZ6"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0176"
FT                   /protein_id="ADP73047.1"
FT                   /translation="MNAKDLVALNNEKRKQLNEHNRNYYENMLVYIRSQLLLSEQQSEE
FT                   LLMELLDHLLEAQKHGKMAEDIFGTDAKAYCDELIRQLPKEKKRNIYAFIGYLAVRLFA
FT                   LGVLVTGAVELVAEWFTDVDDTVYLGKASVLFVIDFAVILLAVALVMRWIRKSAFHDDS
FT                   STFGGKVKEFLGIWFACCLVIGMFVLAEKLVPEFGYRIEAGGMVRILFGLFVFAVTWRL
FT                   NKKFRITK"
     MNAKDLVALN NEKRKQLNEH NRNYYENMLV YIRSQLLLSE QQSEELLMEL LDHLLEAQKH        60
     GKMAEDIFGT DAKAYCDELI RQLPKEKKRN IYAFIGYLAV RLFALGVLVT GAVELVAEWF       120
     TDVDDTVYLG KASVLFVIDF AVILLAVALV MRWIRKSAFH DDSSTFGGKV KEFLGIWFAC       180
     CLVIGMFVLA EKLVPEFGYR IEAGGMVRIL FGLFVFAVTW RLNKKFRITK                  230
//

If you have problems or comments...

PBIL Back to PBIL home page