(data stored in SCRATCH zone)

EMBL: CP002293.PE195

CP002293.PE195       Location/Qualifiers
FT   CDS             223266..224606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0200"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: gwc:GWCH70_0431 potassium uptake protein, TrkH
FT                   family; PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73051"
FT                   /db_xref="GOA:A0A0F6BI00"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI00"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADP73051.1"
FT                   /translation="MKKARKYYLDPPKVLVAGFAVIILVGTALLMLPIATNDGKGLPFL
FT                   DALFTATSATCVTGLVVVDTGTAFTLFGQLVILALIQVGGLGFMTFATLFAFLLGKRIS
FT                   LKERLLLQEAMNNLTIEGIVRLVKRVLIFTVVIELIGGLLLAVRFSFDMPLLKAFYFGM
FT                   FHAVSNFNNAGFDLMGNFRSLTGYVEDPVVTLVICALITLGGIGFIVMNEVYEYRQTRR
FT                   FSLHTKVAVATSGILLASSILLIFLLEFHNPNTLEPLSPLGKFLATLYQAVTPRTAGSN
FT                   TLNISDLTQPTLFLIIFLMFVGASPGSTGGGIKTTTFAILLGAVWSQIRGKEDVVFFKK
FT                   RIMYDTIYKSLTVTISGLFIVIFVTMLLTITEQGKDFLMILFEATSAFSTVGLSMGLTP
FT                   ELSPFGKVIIMCTMFAGRVGPLTIAYAVTLHRKPDPFRYPKGKIMIG"
     MKKARKYYLD PPKVLVAGFA VIILVGTALL MLPIATNDGK GLPFLDALFT ATSATCVTGL        60
     VVVDTGTAFT LFGQLVILAL IQVGGLGFMT FATLFAFLLG KRISLKERLL LQEAMNNLTI       120
     EGIVRLVKRV LIFTVVIELI GGLLLAVRFS FDMPLLKAFY FGMFHAVSNF NNAGFDLMGN       180
     FRSLTGYVED PVVTLVICAL ITLGGIGFIV MNEVYEYRQT RRFSLHTKVA VATSGILLAS       240
     SILLIFLLEF HNPNTLEPLS PLGKFLATLY QAVTPRTAGS NTLNISDLTQ PTLFLIIFLM       300
     FVGASPGSTG GGIKTTTFAI LLGAVWSQIR GKEDVVFFKK RIMYDTIYKS LTVTISGLFI       360
     VIFVTMLLTI TEQGKDFLMI LFEATSAFST VGLSMGLTPE LSPFGKVIIM CTMFAGRVGP       420
     LTIAYAVTLH RKPDPFRYPK GKIMIG                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page