(data stored in SCRATCH zone)

EMBL: CP002293.PE196

CP002293.PE196       Location/Qualifiers
FT   CDS             225037..226872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73052"
FT                   /db_xref="GOA:A0A0F6BI01"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI01"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_1068"
FT                   /protein_id="ADP73052.1"
FT                   /translation="MASLKRLLIGSPMETKRLQHEKLPKWKALAVFSSDALSSVAYATE
FT                   EILLVLMLLGTSVFFYSLPIAVAILVLLLLVTLSYRQIIYAFPSGGGAYVVARDHLNTT
FT                   TSLVAGAALMIDYVLTVAVSISSGVAALTSAFPGLLPWKVEIAVALVLLLMILNLRGIT
FT                   ESATVFAYPTYLFIISVLVLIVAGGWQLWHEGWHGFNYKEHASAAHFFASGYSMFILLR
FT                   AFASGCSAMTGIEAISNGVPAFKPDSSKNAAITMGWMSLLLGTMFLGITVLAAGFGVTP
FT                   VEHKTVISQIGHHVFGNSIFFYLFQMITMFILVLAANTSFAGFPQLASIIANDRFLPRS
FT                   LSARGDRLVFSNGIILLSILAIVLIVAFHGETHSLIPLYAVGVFLSFTIGQSGLLKKIW
FT                   KEKEKRNITTLVIVMTGMTVTGLVTVITVVAKFTQGAWLVIVAIPSLVWLFYRIHDHYV
FT                   KLGEQLKLDEQEWTRREKMLKPKVIIPISGVSKVVAQSVQYARSISNDITAVSVIFYEE
FT                   EEQKLRAKWEKFYPDIPLRVIYSPYRTILSPILDYINEVEKQANSSPITILMPQFVVKK
FT                   WWHALLHNQTAVVLRFFLIMKKDIVIATLPYHLKE"
     MASLKRLLIG SPMETKRLQH EKLPKWKALA VFSSDALSSV AYATEEILLV LMLLGTSVFF        60
     YSLPIAVAIL VLLLLVTLSY RQIIYAFPSG GGAYVVARDH LNTTTSLVAG AALMIDYVLT       120
     VAVSISSGVA ALTSAFPGLL PWKVEIAVAL VLLLMILNLR GITESATVFA YPTYLFIISV       180
     LVLIVAGGWQ LWHEGWHGFN YKEHASAAHF FASGYSMFIL LRAFASGCSA MTGIEAISNG       240
     VPAFKPDSSK NAAITMGWMS LLLGTMFLGI TVLAAGFGVT PVEHKTVISQ IGHHVFGNSI       300
     FFYLFQMITM FILVLAANTS FAGFPQLASI IANDRFLPRS LSARGDRLVF SNGIILLSIL       360
     AIVLIVAFHG ETHSLIPLYA VGVFLSFTIG QSGLLKKIWK EKEKRNITTL VIVMTGMTVT       420
     GLVTVITVVA KFTQGAWLVI VAIPSLVWLF YRIHDHYVKL GEQLKLDEQE WTRREKMLKP       480
     KVIIPISGVS KVVAQSVQYA RSISNDITAV SVIFYEEEEQ KLRAKWEKFY PDIPLRVIYS       540
     PYRTILSPIL DYINEVEKQA NSSPITILMP QFVVKKWWHA LLHNQTAVVL RFFLIMKKDI       600
     VIATLPYHLK E                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page