(data stored in ACNUC7421 zone)

EMBL: CP002293.PE198

CP002293.PE198       Location/Qualifiers
FT   CDS             227751..228710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0203"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: gwc:GWCH70_0185
FT                   SpoOM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73054"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI03"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ADP73054.1"
FT                   /translation="MWKKLLSKLGVGAAKVDLVLHHPRVRVGEQLKGEFLIEGGTVEQH
FT                   IRKLEVELQLMVQADGKAYRRTVAVIPVSSSFTIQPGERKALPFSYVLPLHLPITRPRV
FT                   RYAFVTRLDIADGVDAFDQDAIDILPPLPLEKLFHALGNIGFREKPSSGKITAYGQEFA
FT                   FFPTKEWMGVVEEVEFSAQIEENGIRLYLEVDVRSGFGGFHETELKREIFFSNEEIENV
FT                   EEMSGKLRAVIGEMIQQPRSYVGPSHVPYSSYPSQHVSHHHGGHGMMGAIGGFAAGMLA
FT                   GMVAEELLEDVVEDALDDGIEDVMDDIGDWFDGGDDIL"
     MWKKLLSKLG VGAAKVDLVL HHPRVRVGEQ LKGEFLIEGG TVEQHIRKLE VELQLMVQAD        60
     GKAYRRTVAV IPVSSSFTIQ PGERKALPFS YVLPLHLPIT RPRVRYAFVT RLDIADGVDA       120
     FDQDAIDILP PLPLEKLFHA LGNIGFREKP SSGKITAYGQ EFAFFPTKEW MGVVEEVEFS       180
     AQIEENGIRL YLEVDVRSGF GGFHETELKR EIFFSNEEIE NVEEMSGKLR AVIGEMIQQP       240
     RSYVGPSHVP YSSYPSQHVS HHHGGHGMMG AIGGFAAGML AGMVAEELLE DVVEDALDDG       300
     IEDVMDDIGD WFDGGDDIL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page