(data stored in SCRATCH zone)

EMBL: CP002293.PE2

CP002293.PE2         Location/Qualifiers
FT   CDS             1957..3093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: gwc:GWCH70_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72858"
FT                   /db_xref="GOA:A0A0F6BHF7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHF7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP72858.1"
FT                   /translation="MKITIDREALVQSVQDVMKAVSPRTTIPILTGIKITATPQGVTLT
FT                   GSDSDISIESFIPMEDEDKVLVEIAETGSIVLQARFFSEIVKKLPEKTVEIEVQPNFLT
FT                   VIRSGKAEFSLNGLDAEEYPRLPQIEEENVFEIPTDLLKTIIRQTVFAVSVSETRPILT
FT                   GVNWRIEDEELICTATDSHRLALRKAKIETENHQSHNVVIPGKSLNELSKILDDSNAPV
FT                   KIVITANQILFKTKRLLFFSRLLDGNYPETSRLIPTDSKTDIIVNAKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLSDGIIEISSVSPEIGKVTEEIQSESIEGEELKISFSAKYMMDALK
FT                   ALDGTDIKISFTGAMRPFLLRPLHSDSMLQLILPVRTY"
     MKITIDREAL VQSVQDVMKA VSPRTTIPIL TGIKITATPQ GVTLTGSDSD ISIESFIPME        60
     DEDKVLVEIA ETGSIVLQAR FFSEIVKKLP EKTVEIEVQP NFLTVIRSGK AEFSLNGLDA       120
     EEYPRLPQIE EENVFEIPTD LLKTIIRQTV FAVSVSETRP ILTGVNWRIE DEELICTATD       180
     SHRLALRKAK IETENHQSHN VVIPGKSLNE LSKILDDSNA PVKIVITANQ ILFKTKRLLF       240
     FSRLLDGNYP ETSRLIPTDS KTDIIVNAKE FLQAIDRASL LAREGRNNVV KLTTLSDGII       300
     EISSVSPEIG KVTEEIQSES IEGEELKISF SAKYMMDALK ALDGTDIKIS FTGAMRPFLL       360
     RPLHSDSMLQ LILPVRTY                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page