(data stored in ACNUC7421 zone)

EMBL: CP002293.PE20

CP002293.PE20        Location/Qualifiers
FT   CDS             29279..29875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0020"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: Zinc
FT                   finger C4-type, RecR; TOPRIM domain-containing protein;
FT                   KEGG: gwc:GWCH70_0021 recombination protein RecR; SMART:
FT                   Toprim sub domain-containing protein; Helix-hairpin-helix
FT                   DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72876"
FT                   /db_xref="GOA:A0A0F6BHH5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH5"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADP72876.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLTMKEDTVLEFAK
FT                   ALVDAKRNIRYCTICGHITDTDPCYICKDERRDRTTICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLKRLQDEAVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREL"
     MHYPEPISKL IDSFMKLPGI GPKTAVRLAF FVLTMKEDTV LEFAKALVDA KRNIRYCTIC        60
     GHITDTDPCY ICKDERRDRT TICVVQDPKD VIAMEKMKEY NGLYHVLHGA ISPMEGIGPE       120
     DIKIAELLKR LQDEAVQEVI LATNPNIEGE ATAMYISRLL KPTGIKVTRI AHGLPVGGDL       180
     EYADEVTLSK ALEGRREL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page