(data stored in ACNUC7421 zone)

EMBL: CP002293.PE201

CP002293.PE201       Location/Qualifiers
FT   CDS             233278..233478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0207"
FT                   /product="Protein of unknown function DUF3311"
FT                   /note="PFAM: Protein of unknown function DUF3311; KEGG:
FT                   gwc:GWCH70_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73057"
FT                   /db_xref="GOA:A0A0F6BI06"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI06"
FT                   /inference="protein motif:PFAM:PF11755"
FT                   /protein_id="ADP73057.1"
FT                   /translation="MKGIRWLMVLPFLGILGGIPFANKVTPYVLGMPFILFWLVAWVIM
FT                   TSIIMAVVYRFDPDVREEERT"
     MKGIRWLMVL PFLGILGGIP FANKVTPYVL GMPFILFWLV AWVIMTSIIM AVVYRFDPDV        60
     REEERT                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page