(data stored in ACNUC7421 zone)

EMBL: CP002293.PE204

CP002293.PE204       Location/Qualifiers
FT   CDS             complement(237195..238358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0211"
FT                   /product="protein of unknown function DUF819"
FT                   /note="PFAM: protein of unknown function DUF819; KEGG:
FT                   gwc:GWCH70_3170 protein of unknown function DUF819"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73060"
FT                   /db_xref="GOA:A0A0F6BI09"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI09"
FT                   /inference="protein motif:PFAM:PF05684"
FT                   /protein_id="ADP73060.1"
FT                   /translation="MIQDGVVYLSILLAYVALIAFAEQKSKSKLFKVVPGIIFIYVGGA
FT                   LMQTFGVFGKTNSIDNTYNTVRNVLLPAMLILMLLHCDLRKIIKMGPKILLTFFAASFT
FT                   IIIGFTVTYLLLKEFYAKDTWKAFAALSSSWTGGSANMVILQKILDVPENIFGYALIMD
FT                   TVNYSIWVMFMFWLVPFADRFNRWTKAKAIEVPVAADEVATTTENHQGKMGFTELIVLL
FT                   GFSILLSTICTEIGNALPELGAVFNGTTWTIVFASVIGLLLAMTKAAKIPGANDVSKVM
FT                   LYVIIALIASKADFSQLFQAPIYIISGFLILLIHALLMLIIAKVCKLDLFTMGVTSLAN
FT                   IGGVASTPILAGAYHQSLIPVGILTALLGNLLGTYYGLLTARILSSL"
     MIQDGVVYLS ILLAYVALIA FAEQKSKSKL FKVVPGIIFI YVGGALMQTF GVFGKTNSID        60
     NTYNTVRNVL LPAMLILMLL HCDLRKIIKM GPKILLTFFA ASFTIIIGFT VTYLLLKEFY       120
     AKDTWKAFAA LSSSWTGGSA NMVILQKILD VPENIFGYAL IMDTVNYSIW VMFMFWLVPF       180
     ADRFNRWTKA KAIEVPVAAD EVATTTENHQ GKMGFTELIV LLGFSILLST ICTEIGNALP       240
     ELGAVFNGTT WTIVFASVIG LLLAMTKAAK IPGANDVSKV MLYVIIALIA SKADFSQLFQ       300
     APIYIISGFL ILLIHALLML IIAKVCKLDL FTMGVTSLAN IGGVASTPIL AGAYHQSLIP       360
     VGILTALLGN LLGTYYGLLT ARILSSL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page