(data stored in ACNUC7421 zone)

EMBL: CP002293.PE206

CP002293.PE206       Location/Qualifiers
FT   CDS             239106..240092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0213"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: gtn:GTNG_3175 transcriptional repressor of the
FT                   ribose operon; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73062"
FT                   /db_xref="GOA:A0A0F6BI11"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI11"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73062.1"
FT                   /translation="MMATIRDVAKLAGVSVATVSRVLNQNGYVNEETEKRVRQAMKELN
FT                   YKPSEVARALFKKTSKTIGLIVPDITNPFFPELVRAVEDVMNIYDYTVILCNSDEKTEK
FT                   EKKYIEVLKQKYVDGIILTTNQLELEEVSEWNVPMVVLDRPLSHNYPSVIADNYGGARL
FT                   ATKHLYDIGCRKIAHIQGPSHVVNAMERFHGYRDEMMELGLWDERLVILGNYQLKKAKE
FT                   AVIEALNKYDIDGIFAGNDAMAVGALKAVQQMGFRVPEDIAIIGYDGIPLTEMTTPELS
FT                   TISQPIYDMGAIAARILIKQIEGKPLEKLHYVLPVELVVRQSTRRGE"
     MMATIRDVAK LAGVSVATVS RVLNQNGYVN EETEKRVRQA MKELNYKPSE VARALFKKTS        60
     KTIGLIVPDI TNPFFPELVR AVEDVMNIYD YTVILCNSDE KTEKEKKYIE VLKQKYVDGI       120
     ILTTNQLELE EVSEWNVPMV VLDRPLSHNY PSVIADNYGG ARLATKHLYD IGCRKIAHIQ       180
     GPSHVVNAME RFHGYRDEMM ELGLWDERLV ILGNYQLKKA KEAVIEALNK YDIDGIFAGN       240
     DAMAVGALKA VQQMGFRVPE DIAIIGYDGI PLTEMTTPEL STISQPIYDM GAIAARILIK       300
     QIEGKPLEKL HYVLPVELVV RQSTRRGE                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page