(data stored in ACNUC7421 zone)

EMBL: CP002293.PE207

CP002293.PE207       Location/Qualifiers
FT   CDS             240095..240991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0214"
FT                   /product="ribokinase"
FT                   /note="KEGG: gwc:GWCH70_3167 ribokinase; TIGRFAM:
FT                   ribokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73063"
FT                   /db_xref="GOA:A0A0F6BI12"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI12"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ADP73063.1"
FT                   /translation="MTKPVITVVGSINMDLVTIASRFPSQGETILGEEFHLIPGGKGAN
FT                   QAVAAARLGAEVHMIGAVGTDPFGNELLRSLEREGVHIDNVKPVTHKGTGIASITILEQ
FT                   DNRIIVVPGANHALRPEDIDRYEEIIAKSDVCVLQLEIPLSVVERAVFLAKKHHVRVIL
FT                   NPAPAQPLPQKLIEQADFLTPNEHEREIIFEQVDVDVFADKVIVTEGARGVTIRKDGKQ
FT                   VLIPSFCVPVVDTTGAGDTFNGALAVALSKGMSLEDACRFANAAAALSVTKLGAQGGMP
FT                   TEEEVKKFLQEKAGCSS"
     MTKPVITVVG SINMDLVTIA SRFPSQGETI LGEEFHLIPG GKGANQAVAA ARLGAEVHMI        60
     GAVGTDPFGN ELLRSLEREG VHIDNVKPVT HKGTGIASIT ILEQDNRIIV VPGANHALRP       120
     EDIDRYEEII AKSDVCVLQL EIPLSVVERA VFLAKKHHVR VILNPAPAQP LPQKLIEQAD       180
     FLTPNEHERE IIFEQVDVDV FADKVIVTEG ARGVTIRKDG KQVLIPSFCV PVVDTTGAGD       240
     TFNGALAVAL SKGMSLEDAC RFANAAAALS VTKLGAQGGM PTEEEVKKFL QEKAGCSS         298
//

If you have problems or comments...

PBIL Back to PBIL home page