(data stored in SCRATCH zone)

EMBL: CP002293.PE209

CP002293.PE209       Location/Qualifiers
FT   CDS             241414..242910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0216"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afl:Aflv_2670 ABC-type ribose transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73065"
FT                   /db_xref="GOA:A0A0F6BI14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI14"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73065.1"
FT                   /translation="MTKPFVEMRGIKKAFHQHVVLNDVDFEVRAGEVHALMGENGAGKS
FT                   TLMKVLTGIYERDAGTVLVDGREVHYRHPKEAERDGISVIHQELTIIPTLTVAENIFLG
FT                   RESTIGRTGIIRGKDMEKQAKVYLEKLGIHIDPNELAGNLSVGKQQIVEIARALSTNAK
FT                   CLIMDEPTAALTEREIQTLFEVIRTLKQQGVAIVYISHRMEEIFTICDRISVLRDGQFI
FT                   GTKRIAETNFDEIVHMMVGRQIGERFPKRNTIIGEERMRVEGLTQEGVFENVSFSVRAG
FT                   EILGVAGLMGSGRTEIMEAIFGARKMNAGTIYIDGQPVHITSPRRAIEHGIAMITEDRK
FT                   QKGLILDMSVRENLTLPKSEQLAAAGVIQATKEQELVSSLIKKLNIKTASPELEVKALS
FT                   GGNQQKVVFGKWLAMEPRILILDEPTRGVDVGAKKEIYEIMNELTAQGVAIIMVSSELP
FT                   EVLGMSDRIMVVHEGKVRAILENEGIDQETIMRAATGGKA"
     MTKPFVEMRG IKKAFHQHVV LNDVDFEVRA GEVHALMGEN GAGKSTLMKV LTGIYERDAG        60
     TVLVDGREVH YRHPKEAERD GISVIHQELT IIPTLTVAEN IFLGRESTIG RTGIIRGKDM       120
     EKQAKVYLEK LGIHIDPNEL AGNLSVGKQQ IVEIARALST NAKCLIMDEP TAALTEREIQ       180
     TLFEVIRTLK QQGVAIVYIS HRMEEIFTIC DRISVLRDGQ FIGTKRIAET NFDEIVHMMV       240
     GRQIGERFPK RNTIIGEERM RVEGLTQEGV FENVSFSVRA GEILGVAGLM GSGRTEIMEA       300
     IFGARKMNAG TIYIDGQPVH ITSPRRAIEH GIAMITEDRK QKGLILDMSV RENLTLPKSE       360
     QLAAAGVIQA TKEQELVSSL IKKLNIKTAS PELEVKALSG GNQQKVVFGK WLAMEPRILI       420
     LDEPTRGVDV GAKKEIYEIM NELTAQGVAI IMVSSELPEV LGMSDRIMVV HEGKVRAILE       480
     NEGIDQETIM RAATGGKA                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page