(data stored in ACNUC7421 zone)

EMBL: CP002293.PE211

CP002293.PE211       Location/Qualifiers
FT   CDS             243884..244822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0218"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73067"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI16"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73067.1"
FT                   /translation="MKKLASMWLSFLLVIGVLAGCSLDNGATSGKKEEAKKDGSMKIGL
FT                   SISTLNNPFFVTLKEGAEKAAKEEGVELIVVDAQNDSAKQINDIEDLIQQDVDLILVNP
FT                   TDSSAVTSAIESANSANIPVITVDRSADGGNVATHIASDNIAGGKMAGEFLLEQLKNGG
FT                   NIVELEGIPGSSAARERGEGFHQVIDKASNVKVVAKQAADFDRAKGLSVMENILQSHKD
FT                   IQAVFAHNDEMALGALEALEARGMKDVLVVGFDATEDAVKAVKEGKMAATVAQKPELIG
FT                   ENAIKTALKVLNGEKVDKFIPIPLELVTENQ"
     MKKLASMWLS FLLVIGVLAG CSLDNGATSG KKEEAKKDGS MKIGLSISTL NNPFFVTLKE        60
     GAEKAAKEEG VELIVVDAQN DSAKQINDIE DLIQQDVDLI LVNPTDSSAV TSAIESANSA       120
     NIPVITVDRS ADGGNVATHI ASDNIAGGKM AGEFLLEQLK NGGNIVELEG IPGSSAARER       180
     GEGFHQVIDK ASNVKVVAKQ AADFDRAKGL SVMENILQSH KDIQAVFAHN DEMALGALEA       240
     LEARGMKDVL VVGFDATEDA VKAVKEGKMA ATVAQKPELI GENAIKTALK VLNGEKVDKF       300
     IPIPLELVTE NQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page