(data stored in ACNUC7421 zone)

EMBL: CP002293.PE212

CP002293.PE212       Location/Qualifiers
FT   CDS             244920..245375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0219"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: gwc:GWCH70_3166
FT                   VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73068"
FT                   /db_xref="GOA:A0A0F6BI17"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI17"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ADP73068.1"
FT                   /translation="MKGKIQRWSFVVLWCIVIYCFSEFPLFTGENTKRILEAVLGYLPF
FT                   GHGGDGASSPLNFIVRKLAHLTEFGILAVLVWRALEPMRLAYAGAWLFATMYAVTDEWH
FT                   QSFEPGRTATPKDVAIDSCGALLALIGVFLYMRWKKNAHDPAKRDVS"
     MKGKIQRWSF VVLWCIVIYC FSEFPLFTGE NTKRILEAVL GYLPFGHGGD GASSPLNFIV        60
     RKLAHLTEFG ILAVLVWRAL EPMRLAYAGA WLFATMYAVT DEWHQSFEPG RTATPKDVAI       120
     DSCGALLALI GVFLYMRWKK NAHDPAKRDV S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page