(data stored in SCRATCH zone)

EMBL: CP002293.PE214

CP002293.PE214       Location/Qualifiers
FT   CDS             complement(247400..248383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0221"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   gwc:GWCH70_3164 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73070"
FT                   /db_xref="GOA:A0A0F6BI19"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI19"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADP73070.1"
FT                   /translation="MIRFATIGTNWITEAFIEAAKKTEDFALAAVYSRTDEKAKQFAAK
FT                   TGAERTFTNLEELAKSKDIDAVYIASPNSLHAEQAILLMDHGKHVLCEKSMASNTKEVK
FT                   AMIDAARRNGVVLMEAMKTTLLPNFQAVREHLHKIGKIRRYFASYCQYSSRYDAFKQGT
FT                   VLNAFNPAFSNGALMDIGVYCIYPMVVLFGKPNRLQASSLKLESGVDGEGTIIFTYEDM
FT                   DAVVMYSKITNSYLPAEIQGEDGSILIDAIHTPTKVEIRYRNGRTEDITVPQEQPPMYY
FT                   EVKEFIELIKNGKRESEVNSHEHSLLTIALMEEARKQTGIVFPADQ"
     MIRFATIGTN WITEAFIEAA KKTEDFALAA VYSRTDEKAK QFAAKTGAER TFTNLEELAK        60
     SKDIDAVYIA SPNSLHAEQA ILLMDHGKHV LCEKSMASNT KEVKAMIDAA RRNGVVLMEA       120
     MKTTLLPNFQ AVREHLHKIG KIRRYFASYC QYSSRYDAFK QGTVLNAFNP AFSNGALMDI       180
     GVYCIYPMVV LFGKPNRLQA SSLKLESGVD GEGTIIFTYE DMDAVVMYSK ITNSYLPAEI       240
     QGEDGSILID AIHTPTKVEI RYRNGRTEDI TVPQEQPPMY YEVKEFIELI KNGKRESEVN       300
     SHEHSLLTIA LMEEARKQTG IVFPADQ                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page