(data stored in ACNUC7421 zone)

EMBL: CP002293.PE216

CP002293.PE216       Location/Qualifiers
FT   CDS             250035..251117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0223"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; KEGG:
FT                   gwc:GWCH70_3161 pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73072"
FT                   /db_xref="GOA:A0A0F6BI21"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI21"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ADP73072.1"
FT                   /translation="MFDQDQLQFEMVQLLDENGNGDEKTLASFSDEFLVALYRWMRKAR
FT                   VIDERLLKMQRQGRIGTYAPFGGQEAAQIGSVFALESNDWIFPTYREIAACLAHGLPLA
FT                   QIFRYLRGHLSGGRTPEHLNIFPIQIIIGAQTLHATGCAWATKLKGETQVSVCYFGDGA
FT                   TSQGDFHEALNFASVYQVPVIFFCQNNQYAISVPVHKQTASRTIAQKAVAYGMKGVLVD
FT                   GNDALAVYKTVKEAADAARNGGGPVLIEAFTYRLGPHTTSDDPAKYRNAEEAEKWRRKK
FT                   DPLHRLRVLLEKRGIWTEGEEEEWVAQVNGEVTAAYEEAAADGSGSIVDALSCVYGKPS
FT                   KLLQEQKQEAARRKQGKEGK"
     MFDQDQLQFE MVQLLDENGN GDEKTLASFS DEFLVALYRW MRKARVIDER LLKMQRQGRI        60
     GTYAPFGGQE AAQIGSVFAL ESNDWIFPTY REIAACLAHG LPLAQIFRYL RGHLSGGRTP       120
     EHLNIFPIQI IIGAQTLHAT GCAWATKLKG ETQVSVCYFG DGATSQGDFH EALNFASVYQ       180
     VPVIFFCQNN QYAISVPVHK QTASRTIAQK AVAYGMKGVL VDGNDALAVY KTVKEAADAA       240
     RNGGGPVLIE AFTYRLGPHT TSDDPAKYRN AEEAEKWRRK KDPLHRLRVL LEKRGIWTEG       300
     EEEEWVAQVN GEVTAAYEEA AADGSGSIVD ALSCVYGKPS KLLQEQKQEA ARRKQGKEGK       360
//

If you have problems or comments...

PBIL Back to PBIL home page