(data stored in SCRATCH zone)

EMBL: CP002293.PE219

CP002293.PE219       Location/Qualifiers
FT   CDS             253670..255106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0226"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="KEGG: gtn:GTNG_3135 beta-glucosidase-like protein;
FT                   PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73075"
FT                   /db_xref="GOA:A0A0F6BI24"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI24"
FT                   /inference="protein motif:PRIAM:3.2.1.86"
FT                   /protein_id="ADP73075.1"
FT                   /translation="MEHKQLRPFPDRFLWGSASAAYQVEGAWNEDGKGLSVWDVFAKQP
FT                   GRTFKGTNGDVAVDHYHRYKEDVALMAEMGLKAYRFSVAWSRVFPNEKGEINEKGLQFY
FT                   DNLINELLKHNIEPIITLYHWDVPQALMDEYGAWESRQIIDDFHDYAVTLFQRFGDRVK
FT                   YWVTLNEQNLFITFGYRLGLHPPGVKDAKRMYEANHIANLANAKVIQAFRHYVPDGKIG
FT                   PSFAYSPMYPYDCRPENVLAWENAEEFQNHWWMDVYVWGTYPQAAWNYLEQQGWAPTIK
FT                   SGDMELLKAGKPDFMGVNYYRSQTVQYNPLDGVGEGVMNTTGKKGTSTESGIPGLFKIV
FT                   RNPHLEATNWDWEIDPVGLRIGLRRIANRYGLPVFITENGLGEFDKLEDGDIVNDDYRI
FT                   DYLRRHIQEIQRAITDGVDVIGYCTWSFTDLLSWLNGYQKRYGFVYVNRDDESEKDLRR
FT                   IKKKSFYWYKQVIASNGKEL"
     MEHKQLRPFP DRFLWGSASA AYQVEGAWNE DGKGLSVWDV FAKQPGRTFK GTNGDVAVDH        60
     YHRYKEDVAL MAEMGLKAYR FSVAWSRVFP NEKGEINEKG LQFYDNLINE LLKHNIEPII       120
     TLYHWDVPQA LMDEYGAWES RQIIDDFHDY AVTLFQRFGD RVKYWVTLNE QNLFITFGYR       180
     LGLHPPGVKD AKRMYEANHI ANLANAKVIQ AFRHYVPDGK IGPSFAYSPM YPYDCRPENV       240
     LAWENAEEFQ NHWWMDVYVW GTYPQAAWNY LEQQGWAPTI KSGDMELLKA GKPDFMGVNY       300
     YRSQTVQYNP LDGVGEGVMN TTGKKGTSTE SGIPGLFKIV RNPHLEATNW DWEIDPVGLR       360
     IGLRRIANRY GLPVFITENG LGEFDKLEDG DIVNDDYRID YLRRHIQEIQ RAITDGVDVI       420
     GYCTWSFTDL LSWLNGYQKR YGFVYVNRDD ESEKDLRRIK KKSFYWYKQV IASNGKEL         478
//

If you have problems or comments...

PBIL Back to PBIL home page