(data stored in ACNUC7421 zone)

EMBL: CP002293.PE22

CP002293.PE22        Location/Qualifiers
FT   CDS             30196..30462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0022"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: gwc:GWCH70_0023 pro-sigmaK processing
FT                   inhibitor BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72878"
FT                   /db_xref="GOA:A0A0F6BHH7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHH7"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADP72878.1"
FT                   /translation="MEQKFAVVLSLSMIIILLLVGARLKTLKFLGYGMIKLIVGALVLF
FT                   VINAVGGTFHVHIPINFITALICGFLGIPGAAALIIIDKYIVM"
     MEQKFAVVLS LSMIIILLLV GARLKTLKFL GYGMIKLIVG ALVLFVINAV GGTFHVHIPI        60
     NFITALICGF LGIPGAAALI IIDKYIVM                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page