(data stored in SCRATCH zone)

EMBL: CP002293.PE220

CP002293.PE220       Location/Qualifiers
FT   CDS             complement(255131..255865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0227"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: gyc:GYMC61_3311 transcriptional regulator,
FT                   RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73076"
FT                   /db_xref="GOA:A0A0F6BI25"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI25"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ADP73076.1"
FT                   /translation="MFTPEQIARFSELDYIIYNYVTKHANEVVYMRIRELAEEVHVSPP
FT                   TILRFCRKVGCDGFSEFKTKLKLYLQQNERSFITNAQDTLTEFFERTLKIDYQQTIREA
FT                   AAAIARADNVIFVGSGSSGILAEYGSRYFSALKKFSVYIKDPFFPIYGHYFNNCVVIAL
FT                   SVSGETSYTLSQVHRFKEKGSTIISITNRKHCSLANMSDYNLTYYVNTEFVEQTNITTQ
FT                   IPVIYLLESLAKEMYRMLNKPT"
     MFTPEQIARF SELDYIIYNY VTKHANEVVY MRIRELAEEV HVSPPTILRF CRKVGCDGFS        60
     EFKTKLKLYL QQNERSFITN AQDTLTEFFE RTLKIDYQQT IREAAAAIAR ADNVIFVGSG       120
     SSGILAEYGS RYFSALKKFS VYIKDPFFPI YGHYFNNCVV IALSVSGETS YTLSQVHRFK       180
     EKGSTIISIT NRKHCSLANM SDYNLTYYVN TEFVEQTNIT TQIPVIYLLE SLAKEMYRML       240
     NKPT                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page