(data stored in ACNUC7421 zone)

EMBL: CP002293.PE221

CP002293.PE221       Location/Qualifiers
FT   CDS             256107..257123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0228"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: gwc:GWCH70_3158
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73077"
FT                   /db_xref="GOA:A0A0F6BI26"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI26"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADP73077.1"
FT                   /translation="MSRTWWKWVIYAGSIAALIVSASFTIYCAWKVYAYHQPGEGAAAE
FT                   AEKNAFHFVLVPEELDNDYWRLVEQGAKAAAKETGVYLEYAGPRQANIDEHIHILEKAA
FT                   ASKVDGIMTQGLTEKEFTPVINHIVEKNIPVVTIDTDAPTSKRTAYIGTDNYYAGFIAG
FT                   RALEEDMHGKANVAIITGSFTASNQQLRVQGFKDAVKEEKGIHIVAVEESHITRVQAAE
FT                   KAYNILKKHPEVNAFYGTSALDAIGIAKVVEQFHREKGTYIIGFDTLPETIRYLQKGTI
FT                   HATVVQEPYEMGYRAVKMMVDIRKGNNVPSVINTETKVIRKQDLPLRPSRNYEVNHD"
     MSRTWWKWVI YAGSIAALIV SASFTIYCAW KVYAYHQPGE GAAAEAEKNA FHFVLVPEEL        60
     DNDYWRLVEQ GAKAAAKETG VYLEYAGPRQ ANIDEHIHIL EKAAASKVDG IMTQGLTEKE       120
     FTPVINHIVE KNIPVVTIDT DAPTSKRTAY IGTDNYYAGF IAGRALEEDM HGKANVAIIT       180
     GSFTASNQQL RVQGFKDAVK EEKGIHIVAV EESHITRVQA AEKAYNILKK HPEVNAFYGT       240
     SALDAIGIAK VVEQFHREKG TYIIGFDTLP ETIRYLQKGT IHATVVQEPY EMGYRAVKMM       300
     VDIRKGNNVP SVINTETKVI RKQDLPLRPS RNYEVNHD                               338
//

If you have problems or comments...

PBIL Back to PBIL home page