(data stored in SCRATCH zone)

EMBL: CP002293.PE223

CP002293.PE223       Location/Qualifiers
FT   CDS             258570..260120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0230"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: gwc:GWCH70_3156 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73079"
FT                   /db_xref="GOA:A0A0F6BI28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI28"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP73079.1"
FT                   /translation="MKIAIVDDEALERKALQKMIRGHLPTMEVIAEAANGREAVEVADQ
FT                   YKPDVMLMDIKMPGIDGLEAIELIRRKHPEIKFIIVSAFDTFDYAKQAMRHGVKEYLLK
FT                   PSRKEEVVGALQRVYDELMEERRKEEENRELQQRVRQLQKLVEKEWLSVLMLEEVSSQE
FT                   WKQWETLLPFSIDTGMFMVIQFPSGEKREDWKNWIEQVLSEKETTHYIIGKMVDGQMPV
FT                   LFFHDVAVKAFSWKPVIQSLSLELIQQFERQYGTALYIGLGSPASRLEELRHSYYEALA
FT                   AAQYYASQKKAKSGFLPKKSVLAAASGHIEKEKRLLDAVRQGDLEQALLQCYTYIEEEA
FT                   AHHPLSVVQQKLEETFVLLGRMFADFGIAYERTATFHSCRSFEELKKTAAEQLRHMTCH
FT                   ILAWRHQQANGKLGKAKDYIDEHYHHPLTLEEVAEYVDISPCYFSKLFKDRFGMTFIDY
FT                   VTDVRIARAKKEMADPNKSLKEICFLVGYNDPNYFSRVFKKHTGMSPSEYRKKLHAAT"
     MKIAIVDDEA LERKALQKMI RGHLPTMEVI AEAANGREAV EVADQYKPDV MLMDIKMPGI        60
     DGLEAIELIR RKHPEIKFII VSAFDTFDYA KQAMRHGVKE YLLKPSRKEE VVGALQRVYD       120
     ELMEERRKEE ENRELQQRVR QLQKLVEKEW LSVLMLEEVS SQEWKQWETL LPFSIDTGMF       180
     MVIQFPSGEK REDWKNWIEQ VLSEKETTHY IIGKMVDGQM PVLFFHDVAV KAFSWKPVIQ       240
     SLSLELIQQF ERQYGTALYI GLGSPASRLE ELRHSYYEAL AAAQYYASQK KAKSGFLPKK       300
     SVLAAASGHI EKEKRLLDAV RQGDLEQALL QCYTYIEEEA AHHPLSVVQQ KLEETFVLLG       360
     RMFADFGIAY ERTATFHSCR SFEELKKTAA EQLRHMTCHI LAWRHQQANG KLGKAKDYID       420
     EHYHHPLTLE EVAEYVDISP CYFSKLFKDR FGMTFIDYVT DVRIARAKKE MADPNKSLKE       480
     ICFLVGYNDP NYFSRVFKKH TGMSPSEYRK KLHAAT                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page