(data stored in ACNUC7421 zone)

EMBL: CP002293.PE225

CP002293.PE225       Location/Qualifiers
FT   CDS             261622..262593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0232"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_3154
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73081"
FT                   /db_xref="GOA:A0A0F6BI30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI30"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73081.1"
FT                   /translation="METVKTVSERSVTAVPAPRKKRKWTADHWLAIAFLTPSVVLIFIF
FT                   VYGFIGWTGYVSLSNWNSLVPDLSFAGLKNYVYLFHDFRFQADLRNTLVFTILFIGVVI
FT                   VLGQLLAVLLDQKLRGESLFRNIFFFPMALSFVVTGVVWQWLLNPSTGVNLFLKKIGLD
FT                   SKWYTDTTIFGGFHLGKIEFGVPVAIVAVVIAAVWQMTGFAVAMYLAGLRAIPEEVREA
FT                   ARIDGATELQIYRKIIIPLLRPITVSVIIIMAHISLKIFDLIYAMTGPGANFVTDVPGV
FT                   YMFETTFRGNYYANGAAIAVIMLLSVAIFIVPYLISGRKGGA"
     METVKTVSER SVTAVPAPRK KRKWTADHWL AIAFLTPSVV LIFIFVYGFI GWTGYVSLSN        60
     WNSLVPDLSF AGLKNYVYLF HDFRFQADLR NTLVFTILFI GVVIVLGQLL AVLLDQKLRG       120
     ESLFRNIFFF PMALSFVVTG VVWQWLLNPS TGVNLFLKKI GLDSKWYTDT TIFGGFHLGK       180
     IEFGVPVAIV AVVIAAVWQM TGFAVAMYLA GLRAIPEEVR EAARIDGATE LQIYRKIIIP       240
     LLRPITVSVI IIMAHISLKI FDLIYAMTGP GANFVTDVPG VYMFETTFRG NYYANGAAIA       300
     VIMLLSVAIF IVPYLISGRK GGA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page