(data stored in ACNUC7421 zone)

EMBL: CP002293.PE226

CP002293.PE226       Location/Qualifiers
FT   CDS             262593..263414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0233"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gwc:GWCH70_3153
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73082"
FT                   /db_xref="GOA:A0A0F6BI31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI31"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73082.1"
FT                   /translation="MWQRAWSRLFLYAICIFMSLFFLMPVYVMLVTSVKPLDEVTLADM
FT                   WKLPSAFDWSSYQTAFAKLAPNFWNSVYLVVPATLLSAILGALNGYVLSKWKFKGADTI
FT                   FTLILFGMFIPYQSILIPLIQFLREIGLYNTIPGLIFVHVVYGIPITTLMFRNFYAAIP
FT                   DEMIESAKIDGAGFLRIFRYIMLPLSVTGFVVVAIWQFTNIWNEFLFAVTITTSSQQPI
FT                   MVALQNLSGSQIVQWNVQMAGALLAALPTLLVYIFLGKYFVRGLLAGSVKG"
     MWQRAWSRLF LYAICIFMSL FFLMPVYVML VTSVKPLDEV TLADMWKLPS AFDWSSYQTA        60
     FAKLAPNFWN SVYLVVPATL LSAILGALNG YVLSKWKFKG ADTIFTLILF GMFIPYQSIL       120
     IPLIQFLREI GLYNTIPGLI FVHVVYGIPI TTLMFRNFYA AIPDEMIESA KIDGAGFLRI       180
     FRYIMLPLSV TGFVVVAIWQ FTNIWNEFLF AVTITTSSQQ PIMVALQNLS GSQIVQWNVQ       240
     MAGALLAALP TLLVYIFLGK YFVRGLLAGS VKG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page