(data stored in ACNUC7421 zone)

EMBL: CP002293.PE227

CP002293.PE227       Location/Qualifiers
FT   CDS             complement(264609..264848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73083.1"
FT                   /translation="MPYSHFAEDFVKPSKAKSRETPAMLRLPENKKCKPQPLSGIFRIV
FT                   LNHGRLSYPLLTFVLHLPMEEKILGSTSIKAAKS"
     MPYSHFAEDF VKPSKAKSRE TPAMLRLPEN KKCKPQPLSG IFRIVLNHGR LSYPLLTFVL        60
     HLPMEEKILG STSIKAAKS                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page