(data stored in ACNUC7421 zone)

EMBL: CP002293.PE228

CP002293.PE228       Location/Qualifiers
FT   CDS             complement(264900..266288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0235"
FT                   /product="Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A"
FT                   /note="TIGRFAM: Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A; KEGG: gtn:GTNG_3499
FT                   alkane monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73084"
FT                   /db_xref="GOA:A0A0F6BI33"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI33"
FT                   /inference="protein motif:TFAM:TIGR03860"
FT                   /protein_id="ADP73084.1"
FT                   /translation="MAKQIILNAFEMASAMHNSHGLWKHPESKRQRGYKDIEYWIKMAK
FT                   LLERGKFDAVFFADVLGVYDTYRQSKAPSIRDGLQFPVNDASLVIPVMASVTKHLSFAL
FT                   TVSTTYEHPFNIARRFSTLDHLTKGRIAWNVVTSYLPNAARNFGLPEMIKHDQRYDIAD
FT                   EFLEVTYKLWEGSWEDDAFIEDKQNGILIDPDKVHEIHHAGKFFAVEGPHLCEPSPQRT
FT                   PVIYQAGTSERGREFAAKHAECVFVGGPTPERIKYYTNDIKRRAEKYGRNPDNIKVFAF
FT                   LTVIVGKTTEEAEQKFAELNHLWSPDASKAQFSGASGYDLAEYETKDLNAPFEFKNTEH
FT                   GHYKAASLTKDASKKLSIGEALSKLEQLDRESIIVGNPEEVADAIQHRFEESGVDGFNL
FT                   NHLITPSSLEDFIELVIPILQKRGLYKTEYKPGTLREKLFNYGSSLLPEDHPGSAYRSK
FT                   SFIV"
     MAKQIILNAF EMASAMHNSH GLWKHPESKR QRGYKDIEYW IKMAKLLERG KFDAVFFADV        60
     LGVYDTYRQS KAPSIRDGLQ FPVNDASLVI PVMASVTKHL SFALTVSTTY EHPFNIARRF       120
     STLDHLTKGR IAWNVVTSYL PNAARNFGLP EMIKHDQRYD IADEFLEVTY KLWEGSWEDD       180
     AFIEDKQNGI LIDPDKVHEI HHAGKFFAVE GPHLCEPSPQ RTPVIYQAGT SERGREFAAK       240
     HAECVFVGGP TPERIKYYTN DIKRRAEKYG RNPDNIKVFA FLTVIVGKTT EEAEQKFAEL       300
     NHLWSPDASK AQFSGASGYD LAEYETKDLN APFEFKNTEH GHYKAASLTK DASKKLSIGE       360
     ALSKLEQLDR ESIIVGNPEE VADAIQHRFE ESGVDGFNLN HLITPSSLED FIELVIPILQ       420
     KRGLYKTEYK PGTLREKLFN YGSSLLPEDH PGSAYRSKSF IV                          462
//

If you have problems or comments...

PBIL Back to PBIL home page