(data stored in ACNUC7421 zone)

EMBL: CP002293.PE232

CP002293.PE232       Location/Qualifiers
FT   CDS             complement(268957..270282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0239"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
FT                   dehydrogenase domain-containing protein; KEGG:
FT                   gwc:GWCH70_1626 acyl-CoA dehydrogenase type 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73088"
FT                   /db_xref="GOA:A0A0F6BI37"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI37"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADP73088.1"
FT                   /translation="MLRNSQSSGTSFLLPLFNWAHAKECIAGQKYKKGEIMLSIASKKT
FT                   HRSYLSDELSRKFVQNERQEFLLHLASELAEQFHETADIIDQEGRFPFENFQKLKDCNY
FT                   QSLTVPKQYGGEEISLYEFLLMQERLSQGDASTALCIGWHLGVIYDLRERQTWDSEKFK
FT                   WLCHEVVQNKVLINRVATENGTGSPTRGGKPETVAVKRNGKWVITGRKSFASMAIALDY
FT                   SLVTATIQESGKVGSFLVDHRLQGVSVEETWDMIGMRGTRSDDLVLDQVELPEDALVEL
FT                   DQLESPKGNMGRAWLLHVPACFLGIAIAARNYAISFASEYQPNSLPGPIKDVPEVQRKI
FT                   GEIDLELLKARHTLYSVAHRWDTYPEKRMEMSGELAAAKHIAVNSANKVVDLAMRIVGA
FT                   RSLQKSSPLQRYYRDVRAGLHNPPMDDAVISLLAKQALQSFH"
     MLRNSQSSGT SFLLPLFNWA HAKECIAGQK YKKGEIMLSI ASKKTHRSYL SDELSRKFVQ        60
     NERQEFLLHL ASELAEQFHE TADIIDQEGR FPFENFQKLK DCNYQSLTVP KQYGGEEISL       120
     YEFLLMQERL SQGDASTALC IGWHLGVIYD LRERQTWDSE KFKWLCHEVV QNKVLINRVA       180
     TENGTGSPTR GGKPETVAVK RNGKWVITGR KSFASMAIAL DYSLVTATIQ ESGKVGSFLV       240
     DHRLQGVSVE ETWDMIGMRG TRSDDLVLDQ VELPEDALVE LDQLESPKGN MGRAWLLHVP       300
     ACFLGIAIAA RNYAISFASE YQPNSLPGPI KDVPEVQRKI GEIDLELLKA RHTLYSVAHR       360
     WDTYPEKRME MSGELAAAKH IAVNSANKVV DLAMRIVGAR SLQKSSPLQR YYRDVRAGLH       420
     NPPMDDAVIS LLAKQALQSF H                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page