(data stored in SCRATCH zone)

EMBL: CP002293.PE233

CP002293.PE233       Location/Qualifiers
FT   CDS             complement(270380..271708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0240"
FT                   /product="Nitrilotriacetate monooxygenase component
FT                   A/pristinamycin IIA synthase subunit A"
FT                   /note="KEGG: bay:RBAM_003900 YxeK; TIGRFAM:
FT                   Nitrilotriacetate monooxygenase component A/pristinamycin
FT                   IIA synthase subunit A; PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73089"
FT                   /db_xref="GOA:A0A0F6BI38"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI38"
FT                   /inference="protein motif:TFAM:TIGR03860"
FT                   /protein_id="ADP73089.1"
FT                   /translation="MKKKQMKLGVFLMGTGHHIASWRHPHVQADGCEDFAFFHKIAKIA
FT                   EKGKLDMLFLSDGLSFNELSHPAELVRFEPITLLAALSVVTSHIGLAATATTTYNEPFH
FT                   IARKFSSLDHLSKGRAAWNVVTSYYEDEAKNFSQDAHLDHHLRYERAKEFVEVVKGLWD
FT                   SWEKDALVRDKQSGVYFDPKKLHPLNHKGKYFSVKGPLNSSRSPQGRPVLIQAGSSEDG
FT                   VNFAAQIADVIFTAQQTLEEAQHFYRKVKKKAAEFGRNPDEVIIMPGVSPYIGNTEQEA
FT                   REKYEQLQELIVPEIGLAFLSDYLGGIDLSRYSLDDPLPDEIPETNGNKSRRKLIIDLA
FT                   RREHLTIGELYKRIAGSRGHRIIFGTPEQIADQLEEWIIHEGADGFNLMFPYYPDGLSE
FT                   FVDQVIPILQERGLFRKEYEGTTLREHLGLPEPESRYSPAPSQ"
     MKKKQMKLGV FLMGTGHHIA SWRHPHVQAD GCEDFAFFHK IAKIAEKGKL DMLFLSDGLS        60
     FNELSHPAEL VRFEPITLLA ALSVVTSHIG LAATATTTYN EPFHIARKFS SLDHLSKGRA       120
     AWNVVTSYYE DEAKNFSQDA HLDHHLRYER AKEFVEVVKG LWDSWEKDAL VRDKQSGVYF       180
     DPKKLHPLNH KGKYFSVKGP LNSSRSPQGR PVLIQAGSSE DGVNFAAQIA DVIFTAQQTL       240
     EEAQHFYRKV KKKAAEFGRN PDEVIIMPGV SPYIGNTEQE AREKYEQLQE LIVPEIGLAF       300
     LSDYLGGIDL SRYSLDDPLP DEIPETNGNK SRRKLIIDLA RREHLTIGEL YKRIAGSRGH       360
     RIIFGTPEQI ADQLEEWIIH EGADGFNLMF PYYPDGLSEF VDQVIPILQE RGLFRKEYEG       420
     TTLREHLGLP EPESRYSPAP SQ                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page