(data stored in ACNUC7421 zone)

EMBL: CP002293.PE234

CP002293.PE234       Location/Qualifiers
FT   CDS             complement(271739..272515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0241"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gtn:GTNG_2610 putative
FT                   transport system permease protein of aliphatic sulfonates
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73090"
FT                   /db_xref="GOA:A0A0F6BI39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI39"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP73090.1"
FT                   /translation="MKKIRKIYDQIAPWIVPILLLIAWQLFSAIGWISERVLPSPLEVL
FT                   LAAITLTKNGELFTNIGVSFTRAFIGFVIGGGIGLILGLLNGIYPVAEKYLNTTIQMFR
FT                   NIPHLALIPIVILWFGVGEEAKIFLVIIGVFFPIYINTYHGVISVPKDLIEMGKVYGLS
FT                   KWILFSNVIFPSALPSILVGLRYALGVMWLTLIVAETVAASSGIGYMAMNAREFMQLDV
FT                   VVLSILLYALLGKLADSLAKCLERYFLKWNPAYQKK"
     MKKIRKIYDQ IAPWIVPILL LIAWQLFSAI GWISERVLPS PLEVLLAAIT LTKNGELFTN        60
     IGVSFTRAFI GFVIGGGIGL ILGLLNGIYP VAEKYLNTTI QMFRNIPHLA LIPIVILWFG       120
     VGEEAKIFLV IIGVFFPIYI NTYHGVISVP KDLIEMGKVY GLSKWILFSN VIFPSALPSI       180
     LVGLRYALGV MWLTLIVAET VAASSGIGYM AMNAREFMQL DVVVLSILLY ALLGKLADSL       240
     AKCLERYFLK WNPAYQKK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page