(data stored in SCRATCH zone)

EMBL: CP002293.PE237

CP002293.PE237       Location/Qualifiers
FT   CDS             complement(274807..275586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gtn:GTNG_2609 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73093"
FT                   /db_xref="GOA:A0A0F6BI42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI42"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP73093.1"
FT                   /translation="MPETSGVALSIHQLEKSFGHLHVLRKIDLQIASGEFVAIVGKSGC
FT                   GKSTLLRLIAGLEKATSGEIRQNGKTIKELNPQARIMFQEARLLPWRSVLENVGVGLRL
FT                   QKDWKQRAIWALKQVGLEERAHDWPSVLSGGQKQRVSLARALAAQPQLLLLDEPLGALD
FT                   ALTRMEMQALIEEIWQQQKFTALLVTHDVNEAITLADRVVLIEKGTIKMDLPIPLPRPR
FT                   NRSDSAFIELEENVLAHVLEKTSLKKETENLKSAANE"
     MPETSGVALS IHQLEKSFGH LHVLRKIDLQ IASGEFVAIV GKSGCGKSTL LRLIAGLEKA        60
     TSGEIRQNGK TIKELNPQAR IMFQEARLLP WRSVLENVGV GLRLQKDWKQ RAIWALKQVG       120
     LEERAHDWPS VLSGGQKQRV SLARALAAQP QLLLLDEPLG ALDALTRMEM QALIEEIWQQ       180
     QKFTALLVTH DVNEAITLAD RVVLIEKGTI KMDLPIPLPR PRNRSDSAFI ELEENVLAHV       240
     LEKTSLKKET ENLKSAANE                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page