(data stored in ACNUC7421 zone)

EMBL: CP002293.PE240

CP002293.PE240       Location/Qualifiers
FT   CDS             complement(277404..277940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0248"
FT                   /product="FMN reductase"
FT                   /note="KEGG: gym:GYMC10_0654 FMN reductase; TIGRFAM: FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73096"
FT                   /db_xref="GOA:A0A0F6BI45"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI45"
FT                   /inference="protein motif:TFAM:TIGR03567"
FT                   /protein_id="ADP73096.1"
FT                   /translation="MSNVVIINGNPSLTSRLNGMIQYVEQRLAQAGIEIGHIRVAELPP
FT                   EDLIKAKFDSEAILHANKKVEEADGIIIASPVYKAAYTGVLKTYLDLLPQKGLSGKIIL
FT                   PLFIGGTIAHLLSIDYALKPVLSALGGRYILGGVYAVDTWITRNEQEGYSLSEELIHRL
FT                   DEAAAEFADLLQRKN"
     MSNVVIINGN PSLTSRLNGM IQYVEQRLAQ AGIEIGHIRV AELPPEDLIK AKFDSEAILH        60
     ANKKVEEADG IIIASPVYKA AYTGVLKTYL DLLPQKGLSG KIILPLFIGG TIAHLLSIDY       120
     ALKPVLSALG GRYILGGVYA VDTWITRNEQ EGYSLSEELI HRLDEAAAEF ADLLQRKN         178
//

If you have problems or comments...

PBIL Back to PBIL home page