(data stored in ACNUC7421 zone)

EMBL: CP002293.PE243

CP002293.PE243       Location/Qualifiers
FT   CDS             279641..280582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gwc:GWCH70_3148
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73099"
FT                   /db_xref="GOA:A0A0F6BI48"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BI48"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP73099.1"
FT                   /translation="MTNERRVQFIETAMKLFAEKGYYSTSIQDIVDAWGISKGAFYHHF
FT                   SSKEDLMLAIIQHYFEKMLASFTAIPQDSGSEKERFIQQIAAHFANMHEHKDFLQMMMT
FT                   EQFPKISSDIHHYLLKQQTYIFSWYCDRLIEVYGTEIERYVFDVATMLNGMIRQYMFCV
FT                   FLQANKLHAEELARFLVRRLDAIIASFSHEEAPILNKEMLKPLMELEEKEWRILQEKIS
FT                   AHIAHLQKKLLSLSLDKKMQHKIHAALDALEAELMNEESAPKEYVVQGILLYIEKQHIP
FT                   AFADDLASLAKAVQQYMTTNRWERRKWKKKMN"
     MTNERRVQFI ETAMKLFAEK GYYSTSIQDI VDAWGISKGA FYHHFSSKED LMLAIIQHYF        60
     EKMLASFTAI PQDSGSEKER FIQQIAAHFA NMHEHKDFLQ MMMTEQFPKI SSDIHHYLLK       120
     QQTYIFSWYC DRLIEVYGTE IERYVFDVAT MLNGMIRQYM FCVFLQANKL HAEELARFLV       180
     RRLDAIIASF SHEEAPILNK EMLKPLMELE EKEWRILQEK ISAHIAHLQK KLLSLSLDKK       240
     MQHKIHAALD ALEAELMNEE SAPKEYVVQG ILLYIEKQHI PAFADDLASL AKAVQQYMTT       300
     NRWERRKWKK KMN                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page